PDB entry 3x1i

View 3x1i on RCSB PDB site
Description: hPPARgamma Ligand binding domain in complex with 6-oxo-tetracosahexaenoic acid
Class: transcription
Keywords: nuclear receptor, transcription regulation, ligand binding domain, diabetes mellitus, zinc-finger, DNA-binding, transcription, obesity
Deposited on 2014-11-18, released 2015-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3x1ia_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3x1ib_
  • Heterogens: 66B, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3x1iA (A:)
    galnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedk
    ikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkyg
    vheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnaleldd
    sdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtd
    lrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >3x1iA (A:)
    pesadlralakhlydsyiksfpltkakarailtgttdkspfviydmnslmmgedkikeva
    irifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdg
    vlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrp
    gllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikk
    tetdmslhpllqeiykd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3x1iB (B:)
    galnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedk
    ikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkyg
    vheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnaleldd
    sdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtd
    lrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >3x1iB (B:)
    dlralakhlydsyiksfpltkakarailtgkdkspfviydmnslmmgevairifqgcqfr
    sveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvlisegqgfm
    treflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgllnvkpied
    iqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikkpllqeiy