PDB entry 3x0i

View 3x0i on RCSB PDB site
Description: ADP ribose pyrophosphatase in apo state at 0.91 angstrom resolution
Class: hydrolase
Keywords: Nudix motif, ADP ribose hydrolase, ADP ribose, Cytosol, HYDROLASE
Deposited on 2014-10-16, released 2016-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-05-04, with a file datestamp of 2016-04-29.
Experiment type: XRAY
Resolution: 0.91 Å
R-factor: N/A
AEROSPACI score: 0.92 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribose pyrophosphatase
    Species: Thermus thermophilus [TaxId:274]
    Gene: ndx4, TT_C0160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3x0ia_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3x0iA (A:)
    mgrvyyggvertylyrgrilnlalegryeivehkpavavialregrmlfvrqmrpavgla
    pleipagliepgedpleaarrelaeetglsgdltylfsyfvspgftdekthvflaenlke
    veahpdedeaievvwmrpeealerhqrgevefsatglvgvlyyhaflrgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3x0iA (A:)
    ertylyrgrilnlalegryeivehkpavavialregrmlfvrqmrpavglapleipagli
    epgedpleaarrelaeetglsgdltylfsyfvspgftdekthvflaenlkeveahpdede
    aievvwmrpeealerhqrgevefsatglvgvlyyhaflr