PDB entry 3wzq

View 3wzq on RCSB PDB site
Description: Crystal structure of the core streptavidin mutant V212 (Y22S/N23D/S27D/S45N/Y83S/R84K/E101D/R103K/E116N) complexed with iminobiotin long tail (IMNtail) at 1.7 A resolution
Class: biotin binding protein
Keywords: beta-barrel, BIOTIN BINDING PROTEIN
Deposited on 2014-10-01, released 2015-02-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-02-18, with a file datestamp of 2015-02-13.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.2
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (14-End)
      • expression tag (12-13)
      • engineered mutation (23-24)
      • engineered mutation (28)
      • engineered mutation (46)
      • engineered mutation (84-85)
      • engineered mutation (102)
      • engineered mutation (104)
      • engineered mutation (117)
    Domains in SCOPe 2.07: d3wzqa1, d3wzqa2
  • Chain 'B':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (14-End)
      • expression tag (12-13)
      • engineered mutation (23-24)
      • engineered mutation (28)
      • engineered mutation (46)
      • engineered mutation (84-85)
      • engineered mutation (102)
      • engineered mutation (104)
      • engineered mutation (117)
    Domains in SCOPe 2.07: d3wzqb1, d3wzqb2
  • Chain 'C':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (14-End)
      • expression tag (12-13)
      • engineered mutation (23-24)
      • engineered mutation (28)
      • engineered mutation (46)
      • engineered mutation (84-85)
      • engineered mutation (102)
      • engineered mutation (104)
      • engineered mutation (117)
    Domains in SCOPe 2.07: d3wzqc1, d3wzqc2
  • Chain 'D':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (14-End)
      • expression tag (12-13)
      • engineered mutation (23-24)
      • engineered mutation (28)
      • engineered mutation (46)
      • engineered mutation (84-85)
      • engineered mutation (102)
      • engineered mutation (104)
      • engineered mutation (117)
    Domains in SCOPe 2.07: d3wzqd1, d3wzqd2
  • Heterogens: ZOF, P6G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wzqA (A:)
    masmtggqqmgrgsaeagitgtwsdqlgdtfivtagadgaltgtyenavgnaesryvltg
    rydsapatdgsgtalgwtvawknnsknahsattwsgqyvggadakintqwlltsgttnan
    awkstlvghdtftkvkpsaashhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wzqA (A:)
    gsaeagitgtwsdqlgdtfivtagadgaltgtyenavgnaesryvltgrydsapatdgsg
    talgwtvawknnsknahsattwsgqyvggadakintqwlltsgttnanawkstlvghdtf
    tkvkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wzqB (B:)
    masmtggqqmgrgsaeagitgtwsdqlgdtfivtagadgaltgtyenavgnaesryvltg
    rydsapatdgsgtalgwtvawknnsknahsattwsgqyvggadakintqwlltsgttnan
    awkstlvghdtftkvkpsaashhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wzqB (B:)
    gsaeagitgtwsdqlgdtfivtagadgaltgtyenavgnaesryvltgrydsapatdgsg
    talgwtvawknnsknahsattwsgqyvggadakintqwlltsgttnanawkstlvghdtf
    tkvkp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3wzqC (C:)
    masmtggqqmgrgsaeagitgtwsdqlgdtfivtagadgaltgtyenavgnaesryvltg
    rydsapatdgsgtalgwtvawknnsknahsattwsgqyvggadakintqwlltsgttnan
    awkstlvghdtftkvkpsaashhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wzqC (C:)
    gsaeagitgtwsdqlgdtfivtagadgaltgtyenavgnaesryvltgrydsapatdgsg
    talgwtvawknnsknahsattwsgqyvggadakintqwlltsgttnanawkstlvghdtf
    tkvk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3wzqD (D:)
    masmtggqqmgrgsaeagitgtwsdqlgdtfivtagadgaltgtyenavgnaesryvltg
    rydsapatdgsgtalgwtvawknnsknahsattwsgqyvggadakintqwlltsgttnan
    awkstlvghdtftkvkpsaashhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wzqD (D:)
    gsaeagitgtwsdqlgdtfivtagadgaltgtyenavgnaesryvltgrydsapatdgsg
    talgwtvawknnsknahsattwsgqyvggadakintqwlltsgttnanawkstlvghdtf
    tkvkp