PDB entry 3wzp

View 3wzp on RCSB PDB site
Description: Crystal structure of the core streptavidin mutant V21 (Y22S/N23D/S27D/Y83S/R84K/E101D/R103K/E116N) complexed with iminobiotin long tail (IMNtail) at 1.2 A resolution
Class: biotin binding protein
Keywords: beta-barrel, BIOTIN BINDING PROTEIN
Deposited on 2014-10-01, released 2015-02-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-02-18, with a file datestamp of 2015-02-13.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.135
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (2-End)
      • expression tag (1)
      • engineered mutation (11-12)
      • engineered mutation (16)
      • engineered mutation (72-73)
      • engineered mutation (90)
      • engineered mutation (92)
      • engineered mutation (105)
    Domains in SCOPe 2.07: d3wzpa1, d3wzpa2
  • Chain 'B':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (2-End)
      • expression tag (0-1)
      • engineered mutation (11-12)
      • engineered mutation (16)
      • engineered mutation (72-73)
      • engineered mutation (90)
      • engineered mutation (92)
      • engineered mutation (105)
    Domains in SCOPe 2.07: d3wzpb1, d3wzpb2
  • Chain 'C':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (2-End)
      • expression tag (1)
      • engineered mutation (11-12)
      • engineered mutation (16)
      • engineered mutation (72-73)
      • engineered mutation (90)
      • engineered mutation (92)
      • engineered mutation (105)
    Domains in SCOPe 2.07: d3wzpc1, d3wzpc2
  • Chain 'D':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (2-End)
      • expression tag (0-1)
      • engineered mutation (11-12)
      • engineered mutation (16)
      • engineered mutation (72-73)
      • engineered mutation (90)
      • engineered mutation (92)
      • engineered mutation (105)
    Domains in SCOPe 2.07: d3wzpd1, d3wzpd2
  • Heterogens: ZOF, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wzpA (A:)
    gpaeagitgtwsdqlgdtfivtagadgaltgtyesavgnaesryvltgrydsapatdgsg
    talgwtvawknnsknahsattwsgqyvggadakintqwlltsgttnanawkstlvghdtf
    tkvkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wzpA (A:)
    paeagitgtwsdqlgdtfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgt
    algwtvawknnsknahsattwsgqyvggadakintqwlltsgttnanawkstlvghdtft
    kvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wzpB (B:)
    gpaeagitgtwsdqlgdtfivtagadgaltgtyesavgnaesryvltgrydsapatdgsg
    talgwtvawknnsknahsattwsgqyvggadakintqwlltsgttnanawkstlvghdtf
    tkvkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wzpB (B:)
    gpaeagitgtwsdqlgdtfivtagadgaltgtyesavgnaesryvltgrydsapatdgsg
    talgwtvawknnsknahsattwsgqyvggadakintqwlltsgttnanawkstlvghdtf
    tkv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3wzpC (C:)
    gpaeagitgtwsdqlgdtfivtagadgaltgtyesavgnaesryvltgrydsapatdgsg
    talgwtvawknnsknahsattwsgqyvggadakintqwlltsgttnanawkstlvghdtf
    tkvkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wzpC (C:)
    paeagitgtwsdqlgdtfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgt
    algwtvawknnsknahsattwsgqyvggadakintqwlltsgttnanawkstlvghdtft
    kvk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3wzpD (D:)
    gpaeagitgtwsdqlgdtfivtagadgaltgtyesavgnaesryvltgrydsapatdgsg
    talgwtvawknnsknahsattwsgqyvggadakintqwlltsgttnanawkstlvghdtf
    tkvkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wzpD (D:)
    gpaeagitgtwsdqlgdtfivtagadgaltgtyesavgnaesryvltgrydsapatdgsg
    talgwtvawknnsknahsattwsgqyvggadakintqwlltsgttnanawkstlvghdtf
    tkv