PDB entry 3wzo

View 3wzo on RCSB PDB site
Description: Crystal structure of the core streptavidin mutant V21 (Y22S/N23D/S27D/Y83S/R84K/E101D/R103K/E116N) complexed with biotin long tail (BTNtail) at 1.5 A resolution
Class: biotin binding protein
Keywords: beta-barrel, BIOTIN BINDING PROTEIN
Deposited on 2014-10-01, released 2015-02-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-02-18, with a file datestamp of 2015-02-13.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.176
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (2-End)
      • expression tag (0-1)
      • engineered mutation (11-12)
      • engineered mutation (16)
      • engineered mutation (72-73)
      • engineered mutation (90)
      • engineered mutation (92)
      • engineered mutation (105)
    Domains in SCOPe 2.06: d3wzoa1, d3wzoa2
  • Chain 'B':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (2-End)
      • expression tag (0-1)
      • engineered mutation (11-12)
      • engineered mutation (16)
      • engineered mutation (72-73)
      • engineered mutation (90)
      • engineered mutation (92)
      • engineered mutation (105)
    Domains in SCOPe 2.06: d3wzob1, d3wzob2
  • Chain 'C':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (2-End)
      • expression tag (0-1)
      • engineered mutation (11-12)
      • engineered mutation (16)
      • engineered mutation (72-73)
      • engineered mutation (90)
      • engineered mutation (92)
      • engineered mutation (105)
    Domains in SCOPe 2.06: d3wzoc1, d3wzoc2
  • Chain 'D':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (2-End)
      • expression tag (0-1)
      • engineered mutation (11-12)
      • engineered mutation (16)
      • engineered mutation (72-73)
      • engineered mutation (90)
      • engineered mutation (92)
      • engineered mutation (105)
    Domains in SCOPe 2.06: d3wzod1, d3wzod2
  • Heterogens: ZOE, GOL, CD, P6G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wzoA (A:)
    gpaeagitgtwsdqlgdtfivtagadgaltgtyesavgnaesryvltgrydsapatdgsg
    talgwtvawknnsknahsattwsgqyvggadakintqwlltsgttnanawkstlvghdtf
    tkvkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wzoA (A:)
    gpaeagitgtwsdqlgdtfivtagadgaltgtyesavgnaesryvltgrydsapatdgsg
    talgwtvawknnsknahsattwsgqyvggadakintqwlltsgttnanawkstlvghdtf
    tkvkpsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wzoB (B:)
    gpaeagitgtwsdqlgdtfivtagadgaltgtyesavgnaesryvltgrydsapatdgsg
    talgwtvawknnsknahsattwsgqyvggadakintqwlltsgttnanawkstlvghdtf
    tkvkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wzoB (B:)
    gpaeagitgtwsdqlgdtfivtagadgaltgtyesavgnaesryvltgrydsapatdgsg
    talgwtvawknnsknahsattwsgqyvggadakintqwlltsgttnanawkstlvghdtf
    tkvk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3wzoC (C:)
    gpaeagitgtwsdqlgdtfivtagadgaltgtyesavgnaesryvltgrydsapatdgsg
    talgwtvawknnsknahsattwsgqyvggadakintqwlltsgttnanawkstlvghdtf
    tkvkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wzoC (C:)
    gpaeagitgtwsdqlgdtfivtagadgaltgtyesavgnaesryvltgrydsapatdgsg
    talgwtvawknnsknahsattwsgqyvggadakintqwlltsgttnanawkstlvghdtf
    tkvkp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3wzoD (D:)
    gpaeagitgtwsdqlgdtfivtagadgaltgtyesavgnaesryvltgrydsapatdgsg
    talgwtvawknnsknahsattwsgqyvggadakintqwlltsgttnanawkstlvghdtf
    tkvkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wzoD (D:)
    gpaeagitgtwsdqlgdtfivtagadgaltgtyesavgnaesryvltgrydsapatdgsg
    talgwtvawknnsknahsattwsgqyvggadakintqwlltsgttnanawkstlvghdtf
    tkvkp