PDB entry 3wzn

View 3wzn on RCSB PDB site
Description: Crystal structure of the core streptavidin mutant V21 (Y22S/N23D/S27D/Y83S/R84K/E101D/R103K/E116N) complexed with biotin at 1.3 A resolution
Class: biotin binding protein
Keywords: beta-barrel, BIOTIN BINDING PROTEIN
Deposited on 2014-10-01, released 2015-02-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (2-End)
      • expression tag (0-1)
      • engineered mutation (11-12)
      • engineered mutation (16)
      • engineered mutation (72-73)
      • engineered mutation (90)
      • engineered mutation (92)
      • engineered mutation (105)
    Domains in SCOPe 2.07: d3wzna1, d3wzna2
  • Chain 'B':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (2-End)
      • expression tag (0-1)
      • engineered mutation (11-12)
      • engineered mutation (16)
      • engineered mutation (72-73)
      • engineered mutation (90)
      • engineered mutation (92)
      • engineered mutation (105)
    Domains in SCOPe 2.07: d3wznb1, d3wznb2
  • Heterogens: BTN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wznA (A:)
    gpaeagitgtwsdqlgdtfivtagadgaltgtyesavgnaesryvltgrydsapatdgsg
    talgwtvawknnsknahsattwsgqyvggadakintqwlltsgttnanawkstlvghdtf
    tkvkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wznA (A:)
    gpaeagitgtwsdqlgdtfivtagadgaltgtyesavgnaesryvltgrydsapatdgsg
    talgwtvawknnsknahsattwsgqyvggadakintqwlltsgttnanawkstlvghdtf
    tkvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wznB (B:)
    gpaeagitgtwsdqlgdtfivtagadgaltgtyesavgnaesryvltgrydsapatdgsg
    talgwtvawknnsknahsattwsgqyvggadakintqwlltsgttnanawkstlvghdtf
    tkvkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wznB (B:)
    gpaeagitgtwsdqlgdtfivtagadgaltgtyesavgnaesryvltgrydsapatdgsg
    talgwtvawknnsknahsattwsgqyvggadakintqwlltsgttnanawkstlvghdtf
    tkv