PDB entry 3wze

View 3wze on RCSB PDB site
Description: KDR in complex with ligand sorafenib
Class: transferase/transferase inhibitor
Keywords: KDR RECEPTOR KINASE, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2014-09-24, released 2015-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-05-27, with a file datestamp of 2015-05-22.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vascular endothelial growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: KDR, FLK1, VEGFR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wzea_
  • Heterogens: BAX, ACT, DTT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wzeA (A:)
    dehcerlpydaskwefprdrlklgkplgrgafgqvieadafgidktatcrtvavkmlkeg
    athsehralmselkilihighhlnvvnllgactkpggplmvivefckfgnlstylrskrn
    efvpykvapedlykdfltlehlicysfqvakgmeflasrkcihrdlaarnillseknvvk
    icdfglardiykdpdyvrkgdarlplkwmapetifdrvytiqsdvwsfgvllweifslga
    spypgvkideefcrrlkegtrmrapdyttpemyqtmldcwhgepsqrptfselvehlgnl
    lqanaqqdg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wzeA (A:)
    ehcerlpydaskwefprdrlklgkplgrgafgqvieadafgidktatcrtvavkmlkega
    thsehralmselkilihighhlnvvnllgactkpggplmvivefckfgnlstylrskrne
    fvpykdlykdfltlehlicysfqvakgmeflasrkcihrdlaarnillseknvvkicdfg
    lardiykdpdyvrkgarlplkwmapetifdrvytiqsdvwsfgvllweifslgaspypgv
    kideefcrrlkegtrmrapdyttpemyqtmldcwhgepsqrptfselvehlgnllqan