PDB entry 3wz1

View 3wz1 on RCSB PDB site
Description: Catalytic domain of beta-agarase from Microbulbifer thermotolerans JAMB-A94
Class: hydrolase
Keywords: Glycoside hydrolase family 16, Beta-jelly roll fold, Beta-agarase, Agarose, HYDROLASE
Deposited on 2014-09-12, released 2014-11-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-11-19, with a file datestamp of 2014-11-14.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.153
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Agarase
    Species: Microbulbifer thermotolerans [TaxId:252514]
    Gene: agaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3wz1a_
  • Heterogens: NA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wz1A (A:)
    yaadwdgvpvpanpgsgktwelhplsddfnyeapaagkstrfyerwkegfinpwtgpglt
    ewhphysyvsggklaitsgrkpgtnqvylgsitskapltypvymearaklsnmvlasdfw
    flsadsteeidvieaygsdrpgqewyaerlhlshhvfirdpfqdyqptdagswyadgkgt
    kwrdafhrvgvywrdpwhleyyvdgklvrtvsgqdiidpngftggtglskpmyaiinmed
    qnwrsdngitptdaeladpnrntyyvdwvrfykpvpingnat
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wz1A (A:)
    aadwdgvpvpanpgsgktwelhplsddfnyeapaagkstrfyerwkegfinpwtgpglte
    whphysyvsggklaitsgrkpgtnqvylgsitskapltypvymearaklsnmvlasdfwf
    lsadsteeidvieaygsdrpgqewyaerlhlshhvfirdpfqdyqptdagswyadgkgtk
    wrdafhrvgvywrdpwhleyyvdgklvrtvsgqdiidpngftggtglskpmyaiinmedq
    nwrsdngitptdaeladpnrntyyvdwvrfykpvpin