PDB entry 3wyz

View 3wyz on RCSB PDB site
Description: On archaeal homologs of the human RNase P protein Rpp30 in the hyperthermophilic archaeon Thermococcus kodakarensis
Class: hydrolase
Keywords: TIM barrel-like structure, pre-tRNA cleavage, RNA binding, HYDROLASE
Deposited on 2014-09-11, released 2015-09-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease P protein component 3
    Species: Thermococcus kodakarensis KOD1 [TaxId:69014]
    Gene: rnp3, TK1450
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wyza_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wyzA (A:)
    mseeevsfsrdyfvemdvrdeeahelasdwfdevvftkklvledppdwgslkeelkelrg
    kygkvalllvtrkpslirevksrnlkallyvqggdmrinrmaiesgvdalispwfgrkdp
    gfdhtlagmaarrgvaigfslspllnanpygraqilrfmmktwqlvkkyrvprfitssae
    srwevrgprdlmslginigmeipearaslnfyprtivwkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wyzA (A:)
    fsrdyfvemdvrdeeahelasdwfdevvftkklvledppdwgslkeelkelrgkygkval
    llvtrkpslirevksrnlkallyvqggdmrinrmaiesgvdalispwfgrkdpgfdhtla
    gmaarrgvaigfslspllnanpygraqilrfmmktwqlvkkyrvprfitssaesrwevrg
    prdlmslginigmeipearaslnfyprtivwk