PDB entry 3wyq

View 3wyq on RCSB PDB site
Description: Crystal structure of the low-immunogenic core streptavidin mutant LISA-314 (Y22S/Y83S/R84K/E101D/R103K/E116N) at 1.0 A resolution
Class: biotin binding protein
Keywords: beta-barrel, BIOTIN BINDING PROTEIN
Deposited on 2014-09-05, released 2014-12-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-24, with a file datestamp of 2014-12-19.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.138
AEROSPACI score: 0.92 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (0-End)
      • engineered mutation (9)
      • engineered mutation (70-71)
      • engineered mutation (88)
      • engineered mutation (90)
      • engineered mutation (103)
    Domains in SCOPe 2.07: d3wyqa_
  • Chain 'B':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629
      • engineered mutation (9)
      • engineered mutation (70-71)
      • engineered mutation (88)
      • engineered mutation (90)
      • engineered mutation (103)
    Domains in SCOPe 2.07: d3wyqb_
  • Heterogens: BTN, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wyqA (A:)
    aeagitgtwsnqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnsknahsattwsgqyvggadakintqwlltsgttnanawkstlvghdtftk
    vkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wyqA (A:)
    aeagitgtwsnqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnsknahsattwsgqyvggadakintqwlltsgttnanawkstlvghdtftk
    vk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wyqB (B:)
    aeagitgtwsnqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnsknahsattwsgqyvggadakintqwlltsgttnanawkstlvghdtftk
    vkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wyqB (B:)
    eagitgtwsnqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtal
    gwtvawknnsknahsattwsgqyvggadakintqwlltsgttnanawkstlvghdtftkv