PDB entry 3wyo

View 3wyo on RCSB PDB site
Description: Heterodimeric myoglobin formed by domain swapping
Class: oxygen binding
Keywords: Globin, Oxygen Binding
Deposited on 2014-09-04, released 2014-11-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-19, with a file datestamp of 2014-11-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.228
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Equus caballus [TaxId:9796]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68082 (0-152)
      • engineered mutation (63)
      • engineered mutation (67)
      • engineered mutation (84)
      • engineered mutation (140)
    Domains in SCOPe 2.06: d3wyoa_
  • Chain 'B':
    Compound: Myoglobin
    Species: Equus caballus [TaxId:9796]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68082 (0-152)
      • engineered mutation (77-78)
    Domains in SCOPe 2.06: d3wyob_
  • Chain 'C':
    Compound: Myoglobin
    Species: Equus caballus [TaxId:9796]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68082 (0-152)
      • engineered mutation (63)
      • engineered mutation (67)
      • engineered mutation (84)
      • engineered mutation (140)
    Domains in SCOPe 2.06: d3wyoc_
  • Chain 'D':
    Compound: Myoglobin
    Species: Equus caballus [TaxId:9796]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68082 (0-152)
      • engineered mutation (77-78)
    Domains in SCOPe 2.06: d3wyod_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3wyoA (A:)
    glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
    lkkvgtvhltalggilkkkghheaklkplaqshatkhkipikylefisdaiihvlhskhp
    gdfgadaqgamtkalelfrnkiaakykelgfqg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3wyoB (B:)
    glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
    lkkhgtvvltalggilkedghheaelkplaqshatkhkipikylefisdaiihvlhskhp
    gdfgadaqgamtkalelfrndiaakykelgfqg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3wyoC (C:)
    glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
    lkkvgtvhltalggilkkkghheaklkplaqshatkhkipikylefisdaiihvlhskhp
    gdfgadaqgamtkalelfrnkiaakykelgfqg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3wyoD (D:)
    glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
    lkkhgtvvltalggilkedghheaelkplaqshatkhkipikylefisdaiihvlhskhp
    gdfgadaqgamtkalelfrndiaakykelgfqg