PDB entry 3wym

View 3wym on RCSB PDB site
Description: Crystal structure of the catalytic domain of PDE10A complexed with 1-(2-fluoro-4-(1H-pyrazol-1-yl)phenyl)-5-methoxy-3-(1-phenyl-1H-pyrazol-5-yl)pyridazin-4(1H)-one
Class: hydrolase/hydrolase inhibitor
Keywords: HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2014-09-01, released 2014-11-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE10A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wyma_
  • Chain 'B':
    Compound: cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE10A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wymb_
  • Heterogens: MG, ZN, 3K9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wymA (A:)
    tseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrf
    imsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfs
    nsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaii
    atdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltand
    iyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepl
    lkacrdnlsqwekvirgeetatwisspsvaqkaaased
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wymA (A:)
    ewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfims
    vkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsy
    lqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatd
    lalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiya
    efwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllka
    crdnlsqwekvirge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wymB (B:)
    tseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrf
    imsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfs
    nsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaii
    atdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltand
    iyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepl
    lkacrdnlsqwekvirgeetatwisspsvaqkaaased
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wymB (B:)
    ewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfims
    vkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsy
    lqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatd
    lalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiya
    efwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllka
    crdnlsqwekvirge