PDB entry 3wyj

View 3wyj on RCSB PDB site
Description: Structure of E. coli undecaprenyl diphosphate synthase in complex with BPH-789
Class: transferase
Keywords: transferase
Deposited on 2014-08-29, released 2015-02-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-02-04, with a file datestamp of 2015-01-30.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.2
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific)
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: b0174, ispU, JW0169, rth, uppS, yaeS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3wyja_
  • Chain 'B':
    Compound: Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific)
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: b0174, ispU, JW0169, rth, uppS, yaeS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3wyjb_
  • Heterogens: H78, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wyjA (A:)
    mmlsatqplseklpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaann
    giealtlyafssenwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrl
    qerirksealtagntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqh
    vcmhelapvdlvirtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre
    rrfggtepgdeta
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wyjA (A:)
    pahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafssp
    aqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntglt
    lniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtgge
    hrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wyjB (B:)
    mmlsatqplseklpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaann
    giealtlyafssenwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrl
    qerirksealtagntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqh
    vcmhelapvdlvirtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre
    rrfggtepgdeta
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wyjB (B:)
    gcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafssvsal
    melfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntgltlniaany
    ggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtggehrisnfl
    lwqiayaelyftdvlwpdfdeqdfegalnafanrerrfg