PDB entry 3wya

View 3wya on RCSB PDB site
Description: Crystal structure of GDP-bound EF1alpha from Pyrococcus horikoshii
Class: translation
Keywords: multi-domain, GTPase, aminoacyl-tRNA delivery, GTP, stalk protein, TRANSLATION
Deposited on 2014-08-22, released 2014-12-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-12-24, with a file datestamp of 2014-12-19.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.198
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor 1-alpha
    Species: Pyrococcus horikoshii OT3 [TaxId:70601]
    Gene: tuf, PH1484, PHCC033
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3wyaa1, d3wyaa2, d3wyaa3
  • Heterogens: GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wyaA (A:)
    mpkekphvnivfighvdhgksttigrllydtgnipetiikkfeemgekgksfkfawvmdr
    lkeerergitidvahtkfetphryitiidapghrdfvknmitgasqadaavlvvaatdgv
    mpqtkehaflartlgikhiivtinkmdmvnydqkvfekvkaqvekllktlgykdfpvipt
    sawngdnvvkksdkmpwyngptliealdqipepekpidkplripiqdvysikgvgtvpvg
    rvetgklkvgdvvifepastifhkpiqgevksiemhheplqealpgdnigfnvrgvsknd
    ikrgdvaghtdkpptvvrtkdtfkaqiivlnhptaitvgyspvlhahtaqipvrfeqila
    kvdprtgniveenpqfiktgdsaivvlrpmkpvvlepvkeipqlgrfairdmgmtiaagm
    visiqkgehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wyaA (A:)
    kphvnivfighvdhgksttigrllydtgnipkfawvmdrlkeehtkfetphryitiidap
    ghrdfvknmitgasqadaavlvvaatdgvmpqtkehaflartlgikhiivtinkmdmvny
    dqkvfekvkaqvekllktlgykdfpviptsawngdnvvkksdkmpwyngptliealdqip
    epekpidkplripiqdvysikgvgtvpvgrvetgklkvgdvvifepastifhkpiqgevk
    siemhheplqealpgdnigfnvrgvskndikrgdvaghtdkpptvvrtkdtfkaqiivln
    hptaitvgyspvlhahtaqipvrfeqilakvdprtgniveenpqfiktgdsaivvlrpmk
    pvvlepvkeipqlgrfairdmgmtiaagmvisiqkg