PDB entry 3wxm

View 3wxm on RCSB PDB site
Description: Crystal structure of archaeal Pelota and GTP-bound EF1 alpha complex
Class: translation/hydrolase
Keywords: mRNA surveillance, Ribosome, TRANSLATION-HYDROLASE complex
Deposited on 2014-08-04, released 2014-09-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-09-03, with a file datestamp of 2014-08-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.202
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor 1-alpha
    Species: Aeropyrum pernix K1 [TaxId:272557]
    Gene: tuf, APE_1844
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wxma1, d3wxma2, d3wxma3
  • Chain 'B':
    Compound: Protein pelota homolog
    Species: Aeropyrum pernix K1 [TaxId:272557]
    Gene: pelA, APE_1800.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9YAZ5 (20-End)
      • expression tag (18-19)
  • Chain 'C':
    Compound: Elongation factor 1-alpha
    Species: Aeropyrum pernix K1 [TaxId:272557]
    Gene: tuf, APE_1844
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wxmc1, d3wxmc2, d3wxmc3
  • Chain 'D':
    Compound: Protein pelota homolog
    Species: Aeropyrum pernix K1 [TaxId:272557]
    Gene: pelA, APE_1800.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9YAZ5 (20-End)
      • expression tag (18-19)
  • Chain 'E':
    Compound: Elongation factor 1-alpha
    Species: Aeropyrum pernix K1 [TaxId:272557]
    Gene: tuf, APE_1844
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wxme1, d3wxme2, d3wxme3
  • Chain 'F':
    Compound: Protein pelota homolog
    Species: Aeropyrum pernix K1 [TaxId:272557]
    Gene: pelA, APE_1800.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9YAZ5 (20-End)
      • expression tag (19)
  • Chain 'G':
    Compound: Elongation factor 1-alpha
    Species: Aeropyrum pernix K1 [TaxId:272557]
    Gene: tuf, APE_1844
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wxmg1, d3wxmg2, d3wxmg3
  • Chain 'H':
    Compound: Protein pelota homolog
    Species: Aeropyrum pernix K1 [TaxId:272557]
    Gene: pelA, APE_1800.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9YAZ5 (20-End)
      • expression tag (18-19)
  • Heterogens: GTP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wxmA (A:)
    gshmaekphmnlvvighvdhgkstlvghllyrlgyieekklkeleeqaksrgkesfkfaw
    ildkmkeerergitidltfmkfetkkyvftiidapghrdfvknmitgasqadaailvvsa
    rkgefeagmstegqtrehlllartmgieqiivavnkmdapdvnydqkryefvvsvlkkfm
    kglgyqvdkipfipvsawkgdnlierspnmpwyngptlvealdqlqppakpvdkplripv
    qnvysipgagtvpvgrvetgvlrvgdkvvfmppgvvgevrsiemhyqqlqqaepgdnigf
    avrgvsksdikrgdvaghldkpptvaeefearifviwhpsaitvgytpvihvhtasvssr
    iieikakldpktgqvveqnpqflkagdaaivrfkpvkplvvekfseipqlgrfamrdmnr
    tvgigivtdvkpakvdikaklargsgc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wxmA (A:)
    kphmnlvvighvdhgkstlvghllyrlgyieekklkeleeqaksrgkesfkfawildkmk
    eerergitidltfmkfetkkyvftiidapghrdfvknmitgasqadaailvvsarkgefe
    agmstegqtrehlllartmgieqiivavnkmdapdvnydqkryefvvsvlkkfmkglgyq
    vdkipfipvsawkgdnlierspnmpwyngptlvealdqlqppakpvdkplripvqnvysi
    pgagtvpvgrvetgvlrvgdkvvfmppgvvgevrsiemhyqqlqqaepgdnigfavrgvs
    ksdikrgdvaghldkpptvaeefearifviwhpsaitvgytpvihvhtasvssriieika
    kldpktgqvveqnpqflkagdaaivrfkpvkplvvekfseipqlgrfamrdmnrtvgigi
    vtdvkpakvdik
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3wxmC (C:)
    gshmaekphmnlvvighvdhgkstlvghllyrlgyieekklkeleeqaksrgkesfkfaw
    ildkmkeerergitidltfmkfetkkyvftiidapghrdfvknmitgasqadaailvvsa
    rkgefeagmstegqtrehlllartmgieqiivavnkmdapdvnydqkryefvvsvlkkfm
    kglgyqvdkipfipvsawkgdnlierspnmpwyngptlvealdqlqppakpvdkplripv
    qnvysipgagtvpvgrvetgvlrvgdkvvfmppgvvgevrsiemhyqqlqqaepgdnigf
    avrgvsksdikrgdvaghldkpptvaeefearifviwhpsaitvgytpvihvhtasvssr
    iieikakldpktgqvveqnpqflkagdaaivrfkpvkplvvekfseipqlgrfamrdmnr
    tvgigivtdvkpakvdikaklargsgc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wxmC (C:)
    kphmnlvvighvdhgkstlvghllyrlgyieekklkeleeqaksrgkesfkfawildkmk
    eerergitidltfmkfetkkyvftiidapghrdfvknmitgasqadaailvvsarkgefe
    agmstegqtrehlllartmgieqiivavnkmdapdvnydqkryefvvsvlkkfmkglgyq
    vdkipfipvsawkgdnlierspnmpwyngptlvealdqlqppakpvdkplripvqnvysi
    pgagtvpvgrvetgvlrvgdkvvfmppgvvgevrsiemhyqqlqqaepgdnigfavrgvs
    ksdikrgdvaghldkpptvaeefearifviwhpsaitvgytpvihvhtasvssriieika
    kldpktgqvveqnpqflkagdaaivrfkpvkplvvekfseipqlgrfamrdmnrtvgigi
    vtdvkpakvdi
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3wxmE (E:)
    gshmaekphmnlvvighvdhgkstlvghllyrlgyieekklkeleeqaksrgkesfkfaw
    ildkmkeerergitidltfmkfetkkyvftiidapghrdfvknmitgasqadaailvvsa
    rkgefeagmstegqtrehlllartmgieqiivavnkmdapdvnydqkryefvvsvlkkfm
    kglgyqvdkipfipvsawkgdnlierspnmpwyngptlvealdqlqppakpvdkplripv
    qnvysipgagtvpvgrvetgvlrvgdkvvfmppgvvgevrsiemhyqqlqqaepgdnigf
    avrgvsksdikrgdvaghldkpptvaeefearifviwhpsaitvgytpvihvhtasvssr
    iieikakldpktgqvveqnpqflkagdaaivrfkpvkplvvekfseipqlgrfamrdmnr
    tvgigivtdvkpakvdikaklargsgc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wxmE (E:)
    ekphmnlvvighvdhgkstlvghllyrlgyieekklkeleeqaksrgkesfkfawildkm
    keerergitidltfmkfetkkyvftiidapghrdfvknmitgasqadaailvvsarkgef
    eagmstegqtrehlllartmgieqiivavnkmdapdvnydqkryefvvsvlkkfmkglgy
    qvdkipfipvsawkgdnlierspnmpwyngptlvealdqlqppakpvdkplripvqnvys
    ipgagtvpvgrvetgvlrvgdkvvfmppgvvgevrsiemhyqqlqqaepgdnigfavrgv
    sksdikrgdvaghldkpptvaeefearifviwhpsaitvgytpvihvhtasvssriieik
    akldpktgqvveqnpqflkagdaaivrfkpvkplvvekfseipqlgrfamrdmnrtvgig
    ivtdvkpakv
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3wxmG (G:)
    gshmaekphmnlvvighvdhgkstlvghllyrlgyieekklkeleeqaksrgkesfkfaw
    ildkmkeerergitidltfmkfetkkyvftiidapghrdfvknmitgasqadaailvvsa
    rkgefeagmstegqtrehlllartmgieqiivavnkmdapdvnydqkryefvvsvlkkfm
    kglgyqvdkipfipvsawkgdnlierspnmpwyngptlvealdqlqppakpvdkplripv
    qnvysipgagtvpvgrvetgvlrvgdkvvfmppgvvgevrsiemhyqqlqqaepgdnigf
    avrgvsksdikrgdvaghldkpptvaeefearifviwhpsaitvgytpvihvhtasvssr
    iieikakldpktgqvveqnpqflkagdaaivrfkpvkplvvekfseipqlgrfamrdmnr
    tvgigivtdvkpakvdikaklargsgc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wxmG (G:)
    ekphmnlvvighvdhgkstlvghllyrlgyieekklkeleeqaksrgkesfkfawildkm
    keerergitidltfmkfetkkyvftiidapghrdfvknmitgasqadaailvvsarkgef
    eagmstegqtrehlllartmgieqiivavnkmdapdvnydqkryefvvsvlkkfmkglgy
    qvdkipfipvsawkgdnlierspnmpwyngptlvealdqlqppakpvdkplripvqnvys
    ipgagtvpvgrvetgvlrvgdkvvfmppgvvgevrsiemhyqqlqqaepgdnigfavrgv
    sksdikrgdvaghldkpptvaeefearifviwhpsaitvgytpvihvhtasvssriieik
    akldpktgqvveqnpqflkagdaaivrfkpvkplvvekfseipqlgrfamrdmnrtvgig
    ivtdvkpakvdi
    

  • Chain 'H':
    No sequence available.