PDB entry 3wxl

View 3wxl on RCSB PDB site
Description: Crystal structure of trypanosoma brucei gambiense glycerol kinase complex with adp, mg2+, and glycerol
Class: Transferase
Keywords: trypanosoma, glycerol kinase, sugar kinase superfamily, transferase, glycosome
Deposited on 2014-08-01, released 2014-12-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-12-24, with a file datestamp of 2014-12-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.214
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycerol kinase
    Species: Trypanosoma brucei gambiense [TaxId:31285]
    Gene: gk
    Database cross-references and differences (RAF-indexed):
    • Uniprot D3KVM3 (6-End)
      • expression tag (4-5)
    Domains in SCOPe 2.08: d3wxla1, d3wxla2, d3wxla3
  • Chain 'B':
    Compound: glycerol kinase
    Species: Trypanosoma brucei gambiense [TaxId:31285]
    Gene: gk
    Database cross-references and differences (RAF-indexed):
    • Uniprot D3KVM3 (6-End)
      • expression tag (4-5)
    Domains in SCOPe 2.08: d3wxlb1, d3wxlb2, d3wxlb3
  • Chain 'C':
    Compound: glycerol kinase
    Species: Trypanosoma brucei gambiense [TaxId:31285]
    Gene: gk
    Database cross-references and differences (RAF-indexed):
    • Uniprot D3KVM3 (6-End)
      • expression tag (4-5)
    Domains in SCOPe 2.08: d3wxlc1, d3wxlc2, d3wxlc3
  • Chain 'D':
    Compound: glycerol kinase
    Species: Trypanosoma brucei gambiense [TaxId:31285]
    Gene: gk
    Database cross-references and differences (RAF-indexed):
    • Uniprot D3KVM3 (6-End)
      • expression tag (4-5)
    Domains in SCOPe 2.08: d3wxld1, d3wxld2, d3wxld3
  • Heterogens: GOL, ADP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wxlA (A:)
    gidpftmkyvgsidqgttstrfiifderqrpvsvhqvphtqhtphpgwlehdpmeifrsa
    ckcmsvaiaklrqkdasfrkieaigitnqrettvawdrvtkeplcyapvwndlrtyditk
    kvtaelgggdsmfaskitglpvstyfaafkmrwmlenvpavadacrrgtlcfgtidtwlm
    yklsggkafvtdvtnasrtflmdlrtrkwspelceklkipmetlpeirsnselfgyvetd
    ecgvaaalnertpimgsigdqqsalfgnmcfekgeakntygtgcfllmnvgeearfskhg
    llstvgfqvgrdgpcyyalegaiacagatvewmrrnmnlfshiteceklarsvpgtqgiv
    fvpafsgllapywdpsargtivgmtlkttrahviraalqaialqlndvvgsmkrdaglnl
    sslrvdgglskngllmeiqasllgvdilvpsmhettalgaalcaglaagvwtsleevkav
    srrenswktvspsgsamereamiaewrealkrtkwakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wxlA (A:)
    ftmkyvgsidqgttstrfiifderqrpvsvhqvphtqhtphpgwlehdpmeifrsackcm
    svaiaklrqkdasfrkieaigitnqrettvawdrvtkeplcyapvwndlrtyditkkvta
    elgggdsmfaskitglpvstyfaafkmrwmlenvpavadacrrgtlcfgtidtwlmykls
    ggkafvtdvtnasrtflmdlrtrkwspelceklkipmetlpeirsnselfgyvetdecgv
    aaalnertpimgsigdqqsalfgnmcfekgeakntygtgcfllmnvgeearfskhgllst
    vgfqvgrdgpcyyalegaiacagatvewmrrnmnlfshiteceklarsvpgtqgivfvpa
    fsgllapywdpsargtivgmtlkttrahviraalqaialqlndvvgsmkrdaglnlsslr
    vdgglskngllmeiqasllgvdilvpsmhettalgaalcaglaagvwtsleevkavsrre
    nswktvspsgsamereamiaewrealkrtkwak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wxlB (B:)
    gidpftmkyvgsidqgttstrfiifderqrpvsvhqvphtqhtphpgwlehdpmeifrsa
    ckcmsvaiaklrqkdasfrkieaigitnqrettvawdrvtkeplcyapvwndlrtyditk
    kvtaelgggdsmfaskitglpvstyfaafkmrwmlenvpavadacrrgtlcfgtidtwlm
    yklsggkafvtdvtnasrtflmdlrtrkwspelceklkipmetlpeirsnselfgyvetd
    ecgvaaalnertpimgsigdqqsalfgnmcfekgeakntygtgcfllmnvgeearfskhg
    llstvgfqvgrdgpcyyalegaiacagatvewmrrnmnlfshiteceklarsvpgtqgiv
    fvpafsgllapywdpsargtivgmtlkttrahviraalqaialqlndvvgsmkrdaglnl
    sslrvdgglskngllmeiqasllgvdilvpsmhettalgaalcaglaagvwtsleevkav
    srrenswktvspsgsamereamiaewrealkrtkwakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wxlB (B:)
    ftmkyvgsidqgttstrfiifderqrpvsvhqvphtqhtphpgwlehdpmeifrsackcm
    svaiaklrqkdasfrkieaigitnqrettvawdrvtkeplcyapvwndlrtyditkkvta
    elgggdsmfaskitglpvstyfaafkmrwmlenvpavadacrrgtlcfgtidtwlmykls
    ggkafvtdvtnasrtflmdlrtrkwspelceklkipmetlpeirsnselfgyvetdecgv
    aaalnertpimgsigdqqsalfgnmcfekgeakntygtgcfllmnvgeearfskhgllst
    vgfqvgrdgpcyyalegaiacagatvewmrrnmnlfshiteceklarsvpgtqgivfvpa
    fsgllapywdpsargtivgmtlkttrahviraalqaialqlndvvgsmkrdaglnlsslr
    vdgglskngllmeiqasllgvdilvpsmhettalgaalcaglaagvwtsleevkavsrre
    nswktvspsgsamereamiaewrealkrtkwak
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3wxlC (C:)
    gidpftmkyvgsidqgttstrfiifderqrpvsvhqvphtqhtphpgwlehdpmeifrsa
    ckcmsvaiaklrqkdasfrkieaigitnqrettvawdrvtkeplcyapvwndlrtyditk
    kvtaelgggdsmfaskitglpvstyfaafkmrwmlenvpavadacrrgtlcfgtidtwlm
    yklsggkafvtdvtnasrtflmdlrtrkwspelceklkipmetlpeirsnselfgyvetd
    ecgvaaalnertpimgsigdqqsalfgnmcfekgeakntygtgcfllmnvgeearfskhg
    llstvgfqvgrdgpcyyalegaiacagatvewmrrnmnlfshiteceklarsvpgtqgiv
    fvpafsgllapywdpsargtivgmtlkttrahviraalqaialqlndvvgsmkrdaglnl
    sslrvdgglskngllmeiqasllgvdilvpsmhettalgaalcaglaagvwtsleevkav
    srrenswktvspsgsamereamiaewrealkrtkwakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wxlC (C:)
    ftmkyvgsidqgttstrfiifderqrpvsvhqvphtqhtphpgwlehdpmeifrsackcm
    svaiaklrqkdasfrkieaigitnqrettvawdrvtkeplcyapvwndlrtyditkkvta
    elgggdsmfaskitglpvstyfaafkmrwmlenvpavadacrrgtlcfgtidtwlmykls
    ggkafvtdvtnasrtflmdlrtrkwspelceklkipmetlpeirsnselfgyvetdecgv
    aaalnertpimgsigdqqsalfgnmcfekgeakntygtgcfllmnvgeearfskhgllst
    vgfqvgrdgpcyyalegaiacagatvewmrrnmnlfshiteceklarsvpgtqgivfvpa
    fsgllapywdpsargtivgmtlkttrahviraalqaialqlndvvgsmkrdaglnlsslr
    vdgglskngllmeiqasllgvdilvpsmhettalgaalcaglaagvwtsleevkavsrre
    nswktvspsgsamereamiaewrealkrtkwak
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3wxlD (D:)
    gidpftmkyvgsidqgttstrfiifderqrpvsvhqvphtqhtphpgwlehdpmeifrsa
    ckcmsvaiaklrqkdasfrkieaigitnqrettvawdrvtkeplcyapvwndlrtyditk
    kvtaelgggdsmfaskitglpvstyfaafkmrwmlenvpavadacrrgtlcfgtidtwlm
    yklsggkafvtdvtnasrtflmdlrtrkwspelceklkipmetlpeirsnselfgyvetd
    ecgvaaalnertpimgsigdqqsalfgnmcfekgeakntygtgcfllmnvgeearfskhg
    llstvgfqvgrdgpcyyalegaiacagatvewmrrnmnlfshiteceklarsvpgtqgiv
    fvpafsgllapywdpsargtivgmtlkttrahviraalqaialqlndvvgsmkrdaglnl
    sslrvdgglskngllmeiqasllgvdilvpsmhettalgaalcaglaagvwtsleevkav
    srrenswktvspsgsamereamiaewrealkrtkwakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wxlD (D:)
    ftmkyvgsidqgttstrfiifderqrpvsvhqvphtqhtphpgwlehdpmeifrsackcm
    svaiaklrqkdasfrkieaigitnqrettvawdrvtkeplcyapvwndlrtyditkkvta
    elgggdsmfaskitglpvstyfaafkmrwmlenvpavadacrrgtlcfgtidtwlmykls
    ggkafvtdvtnasrtflmdlrtrkwspelceklkipmetlpeirsnselfgyvetdecgv
    aaalnertpimgsigdqqsalfgnmcfekgeakntygtgcfllmnvgeearfskhgllst
    vgfqvgrdgpcyyalegaiacagatvewmrrnmnlfshiteceklarsvpgtqgivfvpa
    fsgllapywdpsargtivgmtlkttrahviraalqaialqlndvvgsmkrdaglnlsslr
    vdgglskngllmeiqasllgvdilvpsmhettalgaalcaglaagvwtsleevkavsrre
    nswktvspsgsamereamiaewrealkrtkwak