PDB entry 3wx9

View 3wx9 on RCSB PDB site
Description: Crystal structure of Pyrococcus horikoshii kynurenine aminotransferase in complex with PMP, GLA, 4AD, 2OG, GLU and KYA
Class: transferase
Keywords: aminotransferase, KYN binding, TRANSFERASE
Deposited on 2014-07-28, released 2014-09-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-09-24, with a file datestamp of 2014-09-19.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: 0.183
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein PH0207
    Species: Pyrococcus horikoshii OT3 [TaxId:70601]
    Gene: KAT, PH0207
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wx9a_
  • Chain 'C':
    Compound: Putative uncharacterized protein PH0207
    Species: Pyrococcus horikoshii OT3 [TaxId:70601]
    Gene: KAT, PH0207
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wx9c_
  • Heterogens: PMP, AKG, G9A, 3EE, GLU, KYA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wx9A (A:)
    mgsshhhhhhssglvprgshmhedvqlniyvhsqegigmeeniksmlgdverffskkale
    mrasevrellklvetsdiislagglpnpktfpkeiirdilveimekyadkalqygttkgf
    tplretlmkwlgkrygisqdndimitsgsqqaldligrvflnpgdivvveaptylaalqa
    fnfyepqyiqiplddegmkveileeklkelksqgkkvkvvytvptfqnpagvtmnedrrk
    yllelaseydfivveddpygelrysgnpekkikaldnegrviylgtfskilapgfrigwm
    vgdpgiirkmeiakqstdlctnvfgqvvawryvdggylekhipeirkfykprrdamleal
    eefmpegvkwtkpeggmfiwvtlpdgidskkmleraikkgvayvpgeafyahrdvkntmr
    lnftyvdedkimegikrlaetikeelka
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wx9A (A:)
    smlgdverffskkalemrasevrellklvetsdiislagglpnpktfpkeiirdilveim
    ekyadkalqygttkgftplretlmkwlgkrygisqdndimitsgsqqaldligrvflnpg
    divvveaptylaalqafnfyepqyiqiplddegmkveileeklkelksqgkkvkvvytvp
    tfqnpagvtmnedrrkyllelaseydfivveddpygelrysgnpekkikaldnegrviyl
    gtfskilapgfrigwmvgdpgiirkmeiakqstdlctnvfgqvvawryvdggylekhipe
    irkfykprrdamlealeefmpegvkwtkpeggmfiwvtlpdgidskkmleraikkgvayv
    pgeafyahrdvkntmrlnftyvdedkimegikrlaetikeelka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3wx9C (C:)
    mgsshhhhhhssglvprgshmhedvqlniyvhsqegigmeeniksmlgdverffskkale
    mrasevrellklvetsdiislagglpnpktfpkeiirdilveimekyadkalqygttkgf
    tplretlmkwlgkrygisqdndimitsgsqqaldligrvflnpgdivvveaptylaalqa
    fnfyepqyiqiplddegmkveileeklkelksqgkkvkvvytvptfqnpagvtmnedrrk
    yllelaseydfivveddpygelrysgnpekkikaldnegrviylgtfskilapgfrigwm
    vgdpgiirkmeiakqstdlctnvfgqvvawryvdggylekhipeirkfykprrdamleal
    eefmpegvkwtkpeggmfiwvtlpdgidskkmleraikkgvayvpgeafyahrdvkntmr
    lnftyvdedkimegikrlaetikeelka
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wx9C (C:)
    smlgdverffskkalemrasevrellklvetsdiislagglpnpktfpkeiirdilveim
    ekyadkalqygttkgftplretlmkwlgkrygisqdndimitsgsqqaldligrvflnpg
    divvveaptylaalqafnfyepqyiqiplddegmkveileeklkelksqgkkvkvvytvp
    tfqnpagvtmnedrrkyllelaseydfivveddpygelrysgnpekkikaldnegrviyl
    gtfskilapgfrigwmvgdpgiirkmeiakqstdlctnvfgqvvawryvdggylekhipe
    irkfykprrdamlealeefmpegvkwtkpeggmfiwvtlpdgidskkmleraikkgvayv
    pgeafyahrdvkntmrlnftyvdedkimegikrlaetikeelka