PDB entry 3wwr

View 3wwr on RCSB PDB site
Description: Crystal structure of the human vitamin D receptor ligand binding domain complexed with 1-((((1S,2R,6R,Z)-2,6-dihydroxy-4-((E)-2-((1R,3aS,7aR)-1-((R)-6-hydroxy-6-methylheptan-2-yl)-7a-methylhexahydro-1H-inden-4(2H)-ylidene)ethylidene)-3-methylenecyclohexyl)oxy)methyl)cyclopropanecarbonitrile
Class: transcription
Keywords: hormone receptor, transcription
Deposited on 2014-06-27, released 2014-12-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 3.18 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vitamin D3 receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: Vdr, Nr1i1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wwra_
  • Heterogens: 3AJ

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wwrA (A:)
    gshmdslrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsql
    smlphladlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddm
    swtcgnqdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrp
    gvqdaalieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrcl
    sfqpecsmkltplvlevfgneis
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wwrA (A:)
    dslrpklseeqqriiailldahhktydptysdfcqfrppvrvndggsvtlelsqlsmlph
    ladlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtcg
    nqdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqda
    alieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqpe
    csmkltplvlevfg