PDB entry 3wwg

View 3wwg on RCSB PDB site
Description: Crystal structure of the N-glycan-deficient variant N448A of isopullulanase complexed with isopanose
Class: hydrolase
Keywords: beta-helix, glycoside hydrolase family 49, Hydrolase
Deposited on 2014-06-17, released 2014-11-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-15, with a file datestamp of 2015-04-10.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isopullulanase
    Species: Aspergillus niger [TaxId:5061]
    Gene: ipuA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00105 (4-548)
      • expression tag (2-3)
      • engineered mutation (432)
    Domains in SCOPe 2.07: d3wwga1, d3wwga2, d3wwga3
  • Chain 'B':
    Compound: Isopullulanase
    Species: Aspergillus niger [TaxId:5061]
    Gene: ipuA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00105 (4-548)
      • expression tag (2-3)
      • engineered mutation (432)
    Domains in SCOPe 2.07: d3wwgb1, d3wwgb2, d3wwgb3
  • Chain 'C':
    Compound: Isopullulanase
    Species: Aspergillus niger [TaxId:5061]
    Gene: ipuA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00105 (4-548)
      • expression tag (2-3)
      • engineered mutation (432)
    Domains in SCOPe 2.07: d3wwgc1, d3wwgc2, d3wwgc3
  • Chain 'D':
    Compound: Isopullulanase
    Species: Aspergillus niger [TaxId:5061]
    Gene: ipuA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00105 (4-548)
      • expression tag (2-3)
      • engineered mutation (432)
    Domains in SCOPe 2.07: d3wwgd1, d3wwgd2, d3wwgd3
  • Heterogens: NAG, MAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wwgA (A:)
    refmavtannsqlltwwhntgeintqtpvadgnvrqsglysvkvqttpassslyydsfvy
    laipgngmsdqlqytqgynqtqawtsflyshdatvkisrngssansnvvirptslnfpvr
    ydnqsvyitvpysptgyrfsvefdddlislapsgarqpenallifaspfensstkpqpgs
    pnsiapapgrvlglnttsastvvfnpgvyyftghdhmvlsssvtwvyfapgayvkgavef
    lstasevkasghgvlsgeqyvwyadpdegyqkasgannnglrmwrgtlgnssqtfvlngv
    tvsappfnsmdwsgnsldlitcrvddykqvgafygqtdglemypgtilqdvfyhtdddgl
    kmyysnvtarnivmwkesvapvvefgwtprntenvlfdnvdvihqayanagnnpgifgav
    nnylyapdglssahstgnsnmtvrnitwsnfraegsssalfrinpiqnldnisiknvsie
    sfeplsintteswmpvwydlnngkqitvtdfsiegftvgnttitasnaasvgridgvdpa
    yagsvhyid
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wwgA (A:)
    fmavtannsqlltwwhntgeintqtpvadgnvrqsglysvkvqttpaslyydsfvylaip
    gngmsdqlqytqgynqtqawtsflyshdatvkisrngsnvvirptslnfpvrydnqsvyi
    tvpysptgyrfsvefdddlislapsgarqpenallifaspfensstkpqpgspnsiapap
    grvlglnttsastvvfnpgvyyftghdhmvlsssvtwvyfapgayvkgaveflstasevk
    asghgvlsgeqyvwyadpdegyqkasgannnglrmwrgtlgnssqtfvlngvtvsappfn
    smdwsgnsldlitcrvddykqvgafygqtdglemypgtilqdvfyhtdddglkmyysnvt
    arnivmwkesvapvvefgwtprntenvlfdnvdvihqayanagnnpgifgavnnylyasa
    hstgnsnmtvrnitwsnfraegsssalfrinpiqnldnisiknvsiesfeplsinttesw
    mpvwydlnngkqitvtdfsiegftvgnttitasnaasvgridgvdpayagsvhyid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wwgB (B:)
    refmavtannsqlltwwhntgeintqtpvadgnvrqsglysvkvqttpassslyydsfvy
    laipgngmsdqlqytqgynqtqawtsflyshdatvkisrngssansnvvirptslnfpvr
    ydnqsvyitvpysptgyrfsvefdddlislapsgarqpenallifaspfensstkpqpgs
    pnsiapapgrvlglnttsastvvfnpgvyyftghdhmvlsssvtwvyfapgayvkgavef
    lstasevkasghgvlsgeqyvwyadpdegyqkasgannnglrmwrgtlgnssqtfvlngv
    tvsappfnsmdwsgnsldlitcrvddykqvgafygqtdglemypgtilqdvfyhtdddgl
    kmyysnvtarnivmwkesvapvvefgwtprntenvlfdnvdvihqayanagnnpgifgav
    nnylyapdglssahstgnsnmtvrnitwsnfraegsssalfrinpiqnldnisiknvsie
    sfeplsintteswmpvwydlnngkqitvtdfsiegftvgnttitasnaasvgridgvdpa
    yagsvhyid
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wwgB (B:)
    fmavtannsqlltwwhntgeintqtpvadgnvrqsglysvkvqttpassslyydsfvyla
    ipgngmsdqlqytqgynqtqawtsflyshdatvkisrngsansnvvirptslnfpvrydn
    qsvyitvpysptgyrfsvefdddlislapsgarqpenallifaspfensstkpqpgspns
    iapapgrvlglnttsastvvfnpgvyyftghdhmvlsssvtwvyfapgayvkgaveflst
    asevkasghgvlsgeqyvwyadpdegyqkasannnglrmwrgtlgnssqtfvlngvtvsa
    ppfnsmdwsgnsldlitcrvddykqvgafygqtdglemypgtilqdvfyhtdddglkmyy
    snvtarnivmwkesvapvvefgwtprntenvlfdnvdvihqayanagnnpgifgavnnyl
    yapssahstgnsnmtvrnitwsnfraegsssalfrinpiqnldnisiknvsiesfeplsi
    ntteswmpvwydlnngkqitvtdfsiegftvgnttitasnaasvgridgvdpayagsvhy
    id
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3wwgC (C:)
    refmavtannsqlltwwhntgeintqtpvadgnvrqsglysvkvqttpassslyydsfvy
    laipgngmsdqlqytqgynqtqawtsflyshdatvkisrngssansnvvirptslnfpvr
    ydnqsvyitvpysptgyrfsvefdddlislapsgarqpenallifaspfensstkpqpgs
    pnsiapapgrvlglnttsastvvfnpgvyyftghdhmvlsssvtwvyfapgayvkgavef
    lstasevkasghgvlsgeqyvwyadpdegyqkasgannnglrmwrgtlgnssqtfvlngv
    tvsappfnsmdwsgnsldlitcrvddykqvgafygqtdglemypgtilqdvfyhtdddgl
    kmyysnvtarnivmwkesvapvvefgwtprntenvlfdnvdvihqayanagnnpgifgav
    nnylyapdglssahstgnsnmtvrnitwsnfraegsssalfrinpiqnldnisiknvsie
    sfeplsintteswmpvwydlnngkqitvtdfsiegftvgnttitasnaasvgridgvdpa
    yagsvhyid
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wwgC (C:)
    fmavtannsqlltwwhntgeintqtpvadgnvrqsglysvkvqttplyydsfvylaipgn
    gmsdqlqytqgynqtqawtsflyshdatvkisrnsansnvvirptslnfpvrydnqsvyi
    tvpysptgyrfsvefdddlislapsgarqpenallifaspfensstkpqpgspnsiapap
    grvlglnttsastvvfnpgvyyftghdhmvlsssvtwvyfapgayvkgaveflstasevk
    asghgvlsgeqyvwyadpdegyqkasgannnglrmwrgtlgnssqtfvlngvtvsappfn
    smdwsgnsldlitcrvddykqvgafygqtdglemypgtilqdvfyhtdddglkmyysnvt
    arnivmwkesvapvvefgwtprntenvlfdnvdvihqayanagnnpgifgavnnylyapd
    glssahstgnsnmtvrnitwsnfraegsssalfrinpiqnldnisiknvsiesfeplsin
    tteswmpvwydlnngkqitvtdfsiegftvgnttitasnaasvgridgvdpayagsvhyi
    d
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3wwgD (D:)
    refmavtannsqlltwwhntgeintqtpvadgnvrqsglysvkvqttpassslyydsfvy
    laipgngmsdqlqytqgynqtqawtsflyshdatvkisrngssansnvvirptslnfpvr
    ydnqsvyitvpysptgyrfsvefdddlislapsgarqpenallifaspfensstkpqpgs
    pnsiapapgrvlglnttsastvvfnpgvyyftghdhmvlsssvtwvyfapgayvkgavef
    lstasevkasghgvlsgeqyvwyadpdegyqkasgannnglrmwrgtlgnssqtfvlngv
    tvsappfnsmdwsgnsldlitcrvddykqvgafygqtdglemypgtilqdvfyhtdddgl
    kmyysnvtarnivmwkesvapvvefgwtprntenvlfdnvdvihqayanagnnpgifgav
    nnylyapdglssahstgnsnmtvrnitwsnfraegsssalfrinpiqnldnisiknvsie
    sfeplsintteswmpvwydlnngkqitvtdfsiegftvgnttitasnaasvgridgvdpa
    yagsvhyid
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wwgD (D:)
    fmavtannsqlltwwhntgeintqtpvadgnvrqsglysvkvqttpassslyydsfvyla
    ipgngmsdqlqytqgynqtqawtsflyshdatvkisrnansnvvirptslnfpvrydnqs
    vyitvpysptgyrfsvefdddlislapsgarqpenallifaspfensstkpqpgspnsia
    papgrvlglnttsastvvfnpgvyyftghdhmvlsssvtwvyfapgayvkgaveflstas
    evkasghgvlsgeqyvwyadpdegyqkasgannnglrmwrgtlgnssqtfvlngvtvsap
    pfnsmdwsgnsldlitcrvddykqvgafygqtdglemypgtilqdvfyhtdddglkmyys
    nvtarnivmwkesvapvvefgwtprntenvlfdnvdvihqayanagnnpgifgavnnydg
    lssahstgnsnmtvrnitwsnfraegsssalfrinpiqnldnisiknvsiesfeplsint
    teswmpvwydlnngkqitvtdfsiegftvgnttitasnaasvgridgvdpayagsvhyid