PDB entry 3ww5

View 3ww5 on RCSB PDB site
Description: Crystal Structure of hen egg white lysozyme mutant N46E/D52S
Class: hydrolase
Keywords: hydrolase
Deposited on 2014-06-17, released 2015-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: Gallus gallus [TaxId:9031]
    Gene: LYZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00698 (0-128)
      • engineered mutation (45)
      • engineered mutation (51)
    Domains in SCOPe 2.07: d3ww5a_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ww5A (A:)
    kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnretdgstsygilqins
    rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
    qawirgcrl