PDB entry 3wvy

View 3wvy on RCSB PDB site
Description: Structure of D48A hen egg white lysozyme in complex with (GlcNAc)4
Class: hydrolase
Keywords: Hydrolase (O-glycosyl), Sugar Binding, HYDROLASE
Deposited on 2014-06-11, released 2015-06-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-06-10, with a file datestamp of 2015-06-05.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: Gallus gallus [TaxId:9031]
    Gene: LYZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00698 (0-128)
      • engineered mutation (47)
    Domains in SCOPe 2.06: d3wvya_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3wvyA (A:)
    kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntagstdygilqins
    rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
    qawirgcrl