PDB entry 3wvm

View 3wvm on RCSB PDB site
Description: The 0.88 angstrom X-ray structure of the human heart fatty acid-binding protein complexed with stearic acid
Class: lipid binding protein
Keywords: antiparallel beta barrel, LIPID BINDING PROTEIN
Deposited on 2014-05-25, released 2015-01-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-01-28, with a file datestamp of 2015-01-23.
Experiment type: XRAY
Resolution: 0.88 Å
R-factor: 0.108
AEROSPACI score: 1.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fatty acid-binding protein, heart
    Species: Homo sapiens [TaxId:9606]
    Gene: FABP3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3wvma_
  • Heterogens: STE, P6G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3wvmA (A:)
mvdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstfkn
teisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltlth
gtavctrtyekea