PDB entry 3wvd

View 3wvd on RCSB PDB site
Description: Crystal structure of Nitrile Hydratase mutant bR56K complexed with Trimethylacetonitrile, photo-activated for 50 min
Class: lyase
Keywords: cysteine sulfinic acid, Cys-SO2H, Cys-SOH, LYASE
Deposited on 2014-05-17, released 2015-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-11-04, with a file datestamp of 2015-10-30.
Experiment type: XRAY
Resolution: 1.18 Å
R-factor: N/A
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitrile hydratase subunit alpha
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: nthA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wvda_
  • Chain 'B':
    Compound: Nitrile hydratase subunit beta
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: nthB, nha2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13449 (0-211)
      • engineered mutation (55)
    Domains in SCOPe 2.07: d3wvdb_
  • Heterogens: FE, MG, TAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wvdA (A:)
    msvtidhttenaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgael
    varawtdpefrqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpi
    lglpptwyksfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagte
    gwsqeqlqeivtkdcligvaipqvptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wvdA (A:)
    naapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpef
    rqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwyks
    feyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqei
    vtkdcligvaipqvpt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3wvdB (B:)
    mdgvhdlagvqgfgkvphtvnadigptfhaewehlpyslmfagvaelgafsvdevkyvve
    rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
    ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
    hvkfaaeelfgsdtdggsvvvdlfegylepaa