PDB entry 3wv6

View 3wv6 on RCSB PDB site
Description: Crystal Structure of a protease-resistant mutant form of human galectin-9
Class: sugar binding protein
Keywords: Beta sandwich, Carbohydrate-binding, Oligosaccharide, SUGAR BINDING PROTEIN
Deposited on 2014-05-16, released 2015-05-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-05-20, with a file datestamp of 2015-05-15.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-9
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS9
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00182 (Start-147)
      • see remark 999 (148-149)
    • Uniprot O00182 (Start-295)
      • engineered mutation (193)
    Domains in SCOPe 2.05: d3wv6a1, d3wv6a2
  • Chain 'B':
    Compound: Galectin-9
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS9
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00182 (Start-147)
      • see remark 999 (148-149)
    • Uniprot O00182 (Start-295)
      • engineered mutation (193)
    Domains in SCOPe 2.05: d3wv6b1, d3wv6b2
  • Heterogens: ZN, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wv6A (A:)
    mafsgsqapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiaf
    hfnprfedggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfv
    qyfhrvpfhrvdtisvngsvqlsyisfqhmtpaippmmyphpaypmpfittilgglypsk
    sillsgtvlpsaqsfhinlcsgnhiafhlnprfdenavvrntqidnswgseerslprkmp
    fvrgqsfsvwilceahclkvavdgqhlfeyyhrlrnlptinrlevggdiqlthvqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wv6A (A:)
    gsqapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiafhfnp
    rfedggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfvqyfh
    rvpfhrvdtisvngsvqlsyisfqhmyphpaypmpfittilgglypsksillsgtvlpsa
    qsfhinlcsgnhiafhlnprfdenavvrntqidnswgseerslprkmpfvrgqsfsvwil
    ceahclkvavdgqhlfeyyhrlrnlptinrlevggdiqlthvqt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wv6B (B:)
    mafsgsqapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiaf
    hfnprfedggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfv
    qyfhrvpfhrvdtisvngsvqlsyisfqhmtpaippmmyphpaypmpfittilgglypsk
    sillsgtvlpsaqsfhinlcsgnhiafhlnprfdenavvrntqidnswgseerslprkmp
    fvrgqsfsvwilceahclkvavdgqhlfeyyhrlrnlptinrlevggdiqlthvqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wv6B (B:)
    gsqapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiafhfnp
    rfedggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfvqyfh
    rvpfhrvdtisvngsvqlsyisfqhmyphpaypmpfittilgglypsksillsgtvlpsa
    qsfhinlcsgnhiafhlnprfdenavvrntqidnswgseerslprkmpfvrgqsfsvwil
    ceahclkvavdgqhlfeyyhrlrnlptinrlevggdiqlthvqt