PDB entry 3wux

View 3wux on RCSB PDB site
Description: Crystal structure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae
Class: Hydrolase
Keywords: alpha6/alpha6-barrel, Hydrolase
Deposited on 2014-05-08, released 2014-05-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-05-28, with a file datestamp of 2014-05-23.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.184
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Unsaturated chondroitin disaccharide hydrolase
    Species: Streptococcus agalactiae [TaxId:211110]
    Gene: gbs1889
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8E372 (Start-397)
      • engineered mutation (114)
      • engineered mutation (369)
    Domains in SCOPe 2.07: d3wuxa_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wuxA (A:)
    mmkikpvkvesienpkrflnsrlltkieveeaiekalkqlyinidyfgeeyptpatfnni
    ykvmdntewtngfwtgclwlayeynqdkklkniahknvlsflnrinnrialdhhnlgfly
    tpsctaeyringdvkaleatikaadklmeryqekggfiqawgelgykehyrliidcllni
    qllffayeqtgdekyrqvavnhfyasannvvrddssafhtfyfdpetgeplkgvtrqgys
    desswargqawgiygiplsyrkmkdyqqiilfkgmtnyflnrlpedkvsywdliftdgsg
    qprdtsatatavcgihemlkylpevdpdketykyamhtmlrslieqysnneliagrplll
    hgvyswhsgsgvdegniwgdyyylealirfykdwelyw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wuxA (A:)
    mkikpvkvesienpkrflnsrlltkieveeaiekalkqlyinidyfgeeyptpatfnniy
    kvmdntewtngfwtgclwlayeynqdkklkniahknvlsflnrinnrialdhhnlgflyt
    psctaeyringdvkaleatikaadklmerliidcllniqllffayeqtgdekyrqvavnh
    fyasannvvrddssafhtfyfdpetgeplkgvtrqgysdesswargqawgiygiplsyrk
    mkdyqqiilfkgmtnyflnrlpedkvsywdliftdgsgqprdtsatatavcgihemlkyl
    pevdpdketykyamhtmlrslieqysnneliagrplllhgvyswhsgsgvdegniwgdyy
    ylealirfykdwelyw