PDB entry 3wud

View 3wud on RCSB PDB site
Description: X-ray crystal structure of Xenopus laevis galectin-Ib
Class: sugar binding protein
Keywords: Beta-Sandwich, Lectin, Carbohydrate/Sugar Binding, SUGAR BINDING PROTEIN
Deposited on 2014-04-23, released 2015-04-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-04-08, with a file datestamp of 2015-04-03.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galectin
    Species: Xenopus laevis [TaxId:8355]
    Gene: lgals1, xgalectin-Ib
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3wuda_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wudA (A:)
    gsmaagmvmnnfslkqghclelkgfipkdaksfainlgkdssnyvihfnprfdhegdtnk
    iicnskeenswgteqrenvfpfqqgaetsicfeyqadhlkvklsdgqefnfpirmpldti
    tflsmdgielkaislh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wudA (A:)
    agmvmnnfslkqghclelkgfipkdaksfainlgkdssnyvihfnprfdhegdtnkiicn
    skeenswgteqrenvfpfqqgaetsicfeyqadhlkvklsdgqefnfpirmpldtitfls
    mdgielkaislh