PDB entry 3wuc

View 3wuc on RCSB PDB site
Description: X-ray crystal structure of Xenopus laevis galectin-Va
Class: sugar binding protein
Keywords: Beta-Sandwich, Lectin, Carbohydrate/Sugar Binding, SUGAR BINDING PROTEIN
Deposited on 2014-04-23, released 2015-04-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-04-08, with a file datestamp of 2015-04-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galectin
    Species: Xenopus laevis [TaxId:8355]
    Gene: L-14, l14-A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3wuca_
  • Chain 'B':
    Compound: galectin
    Species: Xenopus laevis [TaxId:8355]
    Gene: L-14, l14-A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91786 (2-136)
      • expression tag (0-1)
    Domains in SCOPe 2.05: d3wucb_
  • Heterogens: MLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wucA (A:)
    gsmdmepdvritnlnlhkghrvevrgriakgtnrfavdlgtdsrnlichcnprfeysvdk
    ntivlnskqndvwdiekketafpfksgsetmlifdfedcitvhlpdgkeipftcrfpiev
    inylalnnielisisvh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wucA (A:)
    mdmepdvritnlnlhkghrvevrgriakgtnrfavdlgtdsrnlichcnprfeysvdknt
    ivlnskqndvwdiekketafpfksgsetmlifdfedcitvhlpdgkeipftcrfpievin
    ylalnnielisisvh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3wucB (B:)
    gsmdmepdvritnlnlhkghrvevrgriakgtnrfavdlgtdsrnlichcnprfeysvdk
    ntivlnskqndvwdiekketafpfksgsetmlifdfedcitvhlpdgkeipftcrfpiev
    inylalnnielisisvh