PDB entry 3wtb

View 3wtb on RCSB PDB site
Description: Crystal structure of Gox0525
Class: oxidoreductase
Keywords: Dehydrogenase, reductase, OXIDOREDUCTASE
Deposited on 2014-04-09, released 2015-04-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-04-15, with a file datestamp of 2015-04-10.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative oxidoreductase
    Species: Gluconobacter oxydans [TaxId:290633]
    Gene: GOX0525
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5FTJ3 (3-245)
      • expression tag (2)
    Domains in SCOPe 2.05: d3wtba_
  • Chain 'B':
    Compound: Putative oxidoreductase
    Species: Gluconobacter oxydans [TaxId:290633]
    Gene: GOX0525
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5FTJ3 (3-245)
      • expression tag (2)
    Domains in SCOPe 2.05: d3wtbb_
  • Chain 'C':
    Compound: Putative oxidoreductase
    Species: Gluconobacter oxydans [TaxId:290633]
    Gene: GOX0525
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3wtbc_
  • Chain 'D':
    Compound: Putative oxidoreductase
    Species: Gluconobacter oxydans [TaxId:290633]
    Gene: GOX0525
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3wtbd_
  • Chain 'E':
    Compound: Putative oxidoreductase
    Species: Gluconobacter oxydans [TaxId:290633]
    Gene: GOX0525
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3wtbe_
  • Chain 'F':
    Compound: Putative oxidoreductase
    Species: Gluconobacter oxydans [TaxId:290633]
    Gene: GOX0525
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3wtbf_
  • Chain 'G':
    Compound: Putative oxidoreductase
    Species: Gluconobacter oxydans [TaxId:290633]
    Gene: GOX0525
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3wtbg_
  • Chain 'H':
    Compound: Putative oxidoreductase
    Species: Gluconobacter oxydans [TaxId:290633]
    Gene: GOX0525
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3wtbh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wtbA (A:)
    gshmthrvalitggsrgigaaialklaqdgfdiaityarnekaaqkvvsevealgrkava
    vqadggstdgniaaitktheafgrldalvcnagiypygpiaqmtvtqieevlnlnlraam
    vetvealkymktggrliyigsafgerapfpgislyaatkagligftkgvardlgpqgita
    nvvepgpiatdlnpedgaaaavirkftatesygkvndiartvsflaspdasyitgasilv
    dgglva
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wtbA (A:)
    hmthrvalitggsrgigaaialklaqdgfdiaityarnekaaqkvvsevealgrkavavq
    adggstdgniaaitktheafgrldalvcnagiypygpiaqmtvtqieevlnlnlraamve
    tvealkymktggrliyigsafgerapfpgislyaatkagligftkgvardlgpqgitanv
    vepgpiatdlnpedgaaaavirkftatesygkvndiartvsflaspdasyitgasilvdg
    glva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wtbB (B:)
    gshmthrvalitggsrgigaaialklaqdgfdiaityarnekaaqkvvsevealgrkava
    vqadggstdgniaaitktheafgrldalvcnagiypygpiaqmtvtqieevlnlnlraam
    vetvealkymktggrliyigsafgerapfpgislyaatkagligftkgvardlgpqgita
    nvvepgpiatdlnpedgaaaavirkftatesygkvndiartvsflaspdasyitgasilv
    dgglva
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wtbB (B:)
    hmthrvalitggsrgigaaialklaqdgfdiaityarnekaaqkvvsevealgrkavavq
    adggstdgniaaitktheafgrldalvcnagiypygpiaqmtvtqieevlnlnlraamve
    tvealkymktggrliyigsafgerapfpgislyaatkagligftkgvardlgpqgitanv
    vepgpiatdlnpedgaaaavirkftatesygkvndiartvsflaspdasyitgasilvdg
    glva
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3wtbC (C:)
    gshmthrvalitggsrgigaaialklaqdgfdiaityarnekaaqkvvsevealgrkava
    vqadggstdgniaaitktheafgrldalvcnagiypygpiaqmtvtqieevlnlnlraam
    vetvealkymktggrliyigsafgerapfpgislyaatkagligftkgvardlgpqgita
    nvvepgpiatdlnpedgaaaavirkftatesygkvndiartvsflaspdasyitgasilv
    dgglva
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wtbC (C:)
    mthrvalitggsrgigaaialklaqdgfdiaityarnekaaqkvvsevealgrkavavqa
    dggstdgniaaitktheafgrldalvcnagiypygpiaqmtvtqieevlnlnlraamvet
    vealkymktggrliyigsafgerapfpgislyaatkagligftkgvardlgpqgitanvv
    epgpiatdlnpedgaaaavirkftatesygkvndiartvsflaspdasyitgasilvdgg
    lva
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3wtbD (D:)
    gshmthrvalitggsrgigaaialklaqdgfdiaityarnekaaqkvvsevealgrkava
    vqadggstdgniaaitktheafgrldalvcnagiypygpiaqmtvtqieevlnlnlraam
    vetvealkymktggrliyigsafgerapfpgislyaatkagligftkgvardlgpqgita
    nvvepgpiatdlnpedgaaaavirkftatesygkvndiartvsflaspdasyitgasilv
    dgglva
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wtbD (D:)
    mthrvalitggsrgigaaialklaqdgfdiaityarnekaaqkvvsevealgrkavavqa
    dggstdgniaaitktheafgrldalvcnagiypygpiaqmtvtqieevlnlnlraamvet
    vealkymktggrliyigsafgerapfpgislyaatkagligftkgvardlgpqgitanvv
    epgpiatdlnpedgaaaavirkftatesygkvndiartvsflaspdasyitgasilvdgg
    lva
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3wtbE (E:)
    gshmthrvalitggsrgigaaialklaqdgfdiaityarnekaaqkvvsevealgrkava
    vqadggstdgniaaitktheafgrldalvcnagiypygpiaqmtvtqieevlnlnlraam
    vetvealkymktggrliyigsafgerapfpgislyaatkagligftkgvardlgpqgita
    nvvepgpiatdlnpedgaaaavirkftatesygkvndiartvsflaspdasyitgasilv
    dgglva
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wtbE (E:)
    mthrvalitggsrgigaaialklaqdgfdiaityarnekaaqkvvsevealgrkavavqa
    dggstdgniaaitktheafgrldalvcnagiypygpiaqmtvtqieevlnlnlraamvet
    vealkymktggrliyigsafgerapfpgislyaatkagligftkgvardlgpqgitanvv
    epgpiatdlnpedgaaaavirkftatesygkvndiartvsflaspdasyitgasilvdgg
    lva
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3wtbF (F:)
    gshmthrvalitggsrgigaaialklaqdgfdiaityarnekaaqkvvsevealgrkava
    vqadggstdgniaaitktheafgrldalvcnagiypygpiaqmtvtqieevlnlnlraam
    vetvealkymktggrliyigsafgerapfpgislyaatkagligftkgvardlgpqgita
    nvvepgpiatdlnpedgaaaavirkftatesygkvndiartvsflaspdasyitgasilv
    dgglva
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wtbF (F:)
    mthrvalitggsrgigaaialklaqdgfdiaityarnekaaqkvvsevealgrkavavqa
    dggstdgniaaitktheafgrldalvcnagiypygpiaqmtvtqieevlnlnlraamvet
    vealkymktggrliyigsafgerapfpgislyaatkagligftkgvardlgpqgitanvv
    epgpiatdlnpedgaaaavirkftatesygkvndiartvsflaspdasyitgasilvdgg
    lva
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3wtbG (G:)
    gshmthrvalitggsrgigaaialklaqdgfdiaityarnekaaqkvvsevealgrkava
    vqadggstdgniaaitktheafgrldalvcnagiypygpiaqmtvtqieevlnlnlraam
    vetvealkymktggrliyigsafgerapfpgislyaatkagligftkgvardlgpqgita
    nvvepgpiatdlnpedgaaaavirkftatesygkvndiartvsflaspdasyitgasilv
    dgglva
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wtbG (G:)
    mthrvalitggsrgigaaialklaqdgfdiaityarnekaaqkvvsevealgrkavavqa
    dggstdgniaaitktheafgrldalvcnagiypygpiaqmtvtqieevlnlnlraamvet
    vealkymktggrliyigsafgerapfpgislyaatkagligftkgvardlgpqgitanvv
    epgpiatdlnpedgaaaavirkftatesygkvndiartvsflaspdasyitgasilvdgg
    lva
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3wtbH (H:)
    gshmthrvalitggsrgigaaialklaqdgfdiaityarnekaaqkvvsevealgrkava
    vqadggstdgniaaitktheafgrldalvcnagiypygpiaqmtvtqieevlnlnlraam
    vetvealkymktggrliyigsafgerapfpgislyaatkagligftkgvardlgpqgita
    nvvepgpiatdlnpedgaaaavirkftatesygkvndiartvsflaspdasyitgasilv
    dgglva
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wtbH (H:)
    mthrvalitggsrgigaaialklaqdgfdiaityarnekaaqkvvsevealgrkavavqa
    dggstdgniaaitktheafgrldalvcnagiypygpiaqmtvtqieevlnlnlraamvet
    vealkymktggrliyigsafgerapfpgislyaatkagligftkgvardlgpqgitanvv
    epgpiatdlnpedgaaaavirkftatesygkvndiartvsflaspdasyitgasilvdgg
    lva