PDB entry 3wsw

View 3wsw on RCSB PDB site
Description: Crystal structure of minor L-lactate dehydrogenase from Enterococcus mundtii in the ligands-bound form
Class: Oxidoreductase
Keywords: dehydrogenase, Oxidoreductase
Deposited on 2014-03-27, released 2014-09-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-10-01, with a file datestamp of 2014-09-26.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.195
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Enterococcus mundtii [TaxId:53346]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3WSW
  • Chain 'B':
    Compound: l-lactate dehydrogenase
    Species: Enterococcus mundtii [TaxId:53346]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3WSW
    Domains in SCOPe 2.04: d3wswb1, d3wswb2
  • Chain 'C':
    Compound: l-lactate dehydrogenase
    Species: Enterococcus mundtii [TaxId:53346]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3WSW
  • Chain 'D':
    Compound: l-lactate dehydrogenase
    Species: Enterococcus mundtii [TaxId:53346]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3WSW
  • Heterogens: NAD, GOL, FBP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wswB (B:)
    mkktsrkvvivgtgfvgtsiayaminqgvanelvlidvnqekaegealdlldgmawgekn
    vsvwsgtyeecqdanlviltagvnqkpgqtrldlvktnatitrqivkevmasgfdgifvv
    asnpvdiltyltwqesglpasrvvgtgttldttrfrkeialklavdprsvhgyilgehgd
    sevaawshttvggkpimeyvekdhrleendltvladkvknaayeiidrkkatyygigmst
    trivkailnneqavlpvsaylngeygeediftgvpsivdengvreiidlsitpqekamfh
    qsvselkavldtvrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wswB (B:)
    ktsrkvvivgtgfvgtsiayaminqgvanelvlidvnqekaegealdlldgmawgeknvs
    vwsgtyeecqdanlviltagvnqkpgqtrldlvktnatitrqivkevmasgfdgifvvas
    npvdiltyltwqesglpasrvvgtgttldttrfrkeialklavdprsvhgyilgehgdse
    vaawshttvggkpimeyvekdhrleendltvladkvknaayeiidrkkatyygigmsttr
    ivkailnneqavlpvsaylngeygeediftgvpsivdengvreiidlsitpqekamfhqs
    vselkavldtvrl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.