PDB entry 3wso

View 3wso on RCSB PDB site
Description: Crystal structure of the Skp1-FBG3 complex
Class: ligase
Keywords: F-box protein, SCF ubiquitin ligase, Skp1, LIGASE
Deposited on 2014-03-18, released 2015-03-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-11-11, with a file datestamp of 2015-11-06.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: F-box only protein 44
    Species: Homo sapiens [TaxId:9606]
    Gene: FBXO44, FBG3, FBX30, FBX44, FBX6A, FBXO6A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H4M3
      • see remark 999 (250)
  • Chain 'B':
    Compound: S-phase kinase-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SKP1, EMC19, OCP2, SKP1A, TCEB1L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wsob1, d3wsob2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wsoB (B:)
    gphmpsiklqssdgeifevdveiakqsvtiktmledlgmddegdddpvplpnvnaailkk
    viqwcthhkddppppeddenkekrtddipvwdqeflkvdqgtlfelilaanyldikglld
    vtcktvanmikgktpeeirktfnikndfteeeeaqvrkenqwceek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wsoB (B:)
    mpsiklqssdgeifevdveiakqsvtiktmleddpvplpnvnaailkkviqwcthhkddp
    dipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfnikn
    dfteeeeaqvrkenqwcee