PDB entry 3wri

View 3wri on RCSB PDB site
Description: Crystal structure of P450cam
Class: oxidoreductase
Keywords: OXIDOREDUCTASE, Metal-binding, Heme
Deposited on 2014-02-25, released 2015-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-03-18, with a file datestamp of 2015-03-13.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Camphor 5-monooxygenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMC, CYP101
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00183 (Start-414)
      • expression tag (415-416)
    Domains in SCOPe 2.07: d3wria1, d3wria2
  • Chain 'B':
    Compound: Camphor 5-monooxygenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMC, CYP101
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00183 (Start-414)
      • expression tag (415-416)
    Domains in SCOPe 2.07: d3wrib1, d3wrib2
  • Heterogens: HEM, CAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wriA (A:)
    mttetiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcn
    gghwiatrgqlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvv
    gmpvvdklenriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlky
    ltdqmtrpdgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeak
    rmcglllvggldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgr
    iltsdyefhgvqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclg
    qhlarreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkavhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wriA (A:)
    nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
    lireayedyrhfssecpfipraydfiptsmdppeqrqfralanqvvgmpvvdklenriqe
    lacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdgsmtf
    aeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvggldtv
    vnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhgvqlk
    kgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiivtlke
    wltripdfsiapgaqiqhksgivsgvqalplvwdpattkavhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wriB (B:)
    mttetiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcn
    gghwiatrgqlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvv
    gmpvvdklenriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlky
    ltdqmtrpdgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeak
    rmcglllvggldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgr
    iltsdyefhgvqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclg
    qhlarreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkavhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wriB (B:)
    nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
    lireayedyrhfssecpfipraydfiptsmdppeqrqfralanqvvgmpvvdklenriqe
    lacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdgsmtf
    aeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvggldtv
    vnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhgvqlk
    kgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiivtlke
    wltripdfsiapgaqiqhksgivsgvqalplvwdpattkavhh