PDB entry 3wr2

View 3wr2 on RCSB PDB site
Description: RNase Po1 complexed with 3'GMP
Class: Hydrolase
Keywords: RNase, Hydrolase
Deposited on 2014-02-13, released 2015-02-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-02-18, with a file datestamp of 2015-02-13.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.166
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Guanyl-specific ribonuclease Po1
  Species: Pleurotus ostreatus [TaxId:5322]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P81762 (0-100)
  Domains in SCOPe 2.08: d3wr2a_
• Chain 'B':
  Compound: Guanyl-specific ribonuclease Po1
  Species: Pleurotus ostreatus [TaxId:5322]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P81762 (0-100)
  Domains in SCOPe 2.08: d3wr2b_
• Chain 'C':
  Compound: Guanyl-specific ribonuclease Po1
  Species: Pleurotus ostreatus [TaxId:5322]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P81762 (0-100)
  Domains in SCOPe 2.08: d3wr2c_
• Chain 'D':
  Compound: Guanyl-specific ribonuclease Po1
  Species: Pleurotus ostreatus [TaxId:5322]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P81762 (0-100)
  Domains in SCOPe 2.08: d3wr2d_
• Chain 'E':
  Compound: Guanyl-specific ribonuclease Po1
  Species: Pleurotus ostreatus [TaxId:5322]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P81762 (0-100)
  Domains in SCOPe 2.08: d3wr2e_
• Chain 'F':
  Compound: Guanyl-specific ribonuclease Po1
  Species: Pleurotus ostreatus [TaxId:5322]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P81762 (0-100)
  Domains in SCOPe 2.08: d3wr2f_
• Heterogens: 3GP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3wr2A (A:)
  qtgvrscncagrsftgtdvtnairsaraggsgnyphvynnfegfsfsctptffefpvfrg
  svysggspgadrviydqsgrfcaclthtgapstngfvecrf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3wr2B (B:)
  qtgvrscncagrsftgtdvtnairsaraggsgnyphvynnfegfsfsctptffefpvfrg
  svysggspgadrviydqsgrfcaclthtgapstngfvecrf
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3wr2C (C:)
  qtgvrscncagrsftgtdvtnairsaraggsgnyphvynnfegfsfsctptffefpvfrg
  svysggspgadrviydqsgrfcaclthtgapstngfvecrf
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3wr2D (D:)
  qtgvrscncagrsftgtdvtnairsaraggsgnyphvynnfegfsfsctptffefpvfrg
  svysggspgadrviydqsgrfcaclthtgapstngfvecrf
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3wr2E (E:)
  qtgvrscncagrsftgtdvtnairsaraggsgnyphvynnfegfsfsctptffefpvfrg
  svysggspgadrviydqsgrfcaclthtgapstngfvecrf
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3wr2F (F:)
  qtgvrscncagrsftgtdvtnairsaraggsgnyphvynnfegfsfsctptffefpvfrg
  svysggspgadrviydqsgrfcaclthtgapstngfvecrf