PDB entry 3wqh

View 3wqh on RCSB PDB site
Description: Crystal Structure of human DPP-IV in complex with Anagliptin
Class: hydrolase/hydrolase inhibitor
Keywords: DIABETES, BETA-PROPELLER, AMINOPEPTIDASE, MEMBRANE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2014-01-27, released 2015-07-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-07-15, with a file datestamp of 2015-07-10.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dipeptidyl peptidase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DPP4, ADCP2, CD26
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3wqha1, d3wqha2
  • Chain 'B':
    Compound: dipeptidyl peptidase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DPP4, ADCP2, CD26
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3wqhb1, d3wqhb2
  • Heterogens: NAG, SKK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wqhA (A:)
    gpsrktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfd
    efghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvt
    wspvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalww
    spngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdsl
    ssvtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgr
    wnclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctf
    itkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqy
    ysvsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldf
    iilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniiva
    sfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvt
    smvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfk
    qveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythms
    hfikqcfslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wqhA (A:)
    srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
    ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
    pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
    ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
    vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
    clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
    kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
    vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfii
    lnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasf
    dgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsm
    vlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqv
    eyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshf
    ikqcfslp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wqhB (B:)
    gpsrktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfd
    efghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvt
    wspvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalww
    spngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdsl
    ssvtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgr
    wnclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctf
    itkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqy
    ysvsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldf
    iilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniiva
    sfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvt
    smvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfk
    qveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythms
    hfikqcfslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wqhB (B:)
    srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
    ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
    pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
    ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
    vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
    clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
    kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
    vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfii
    lnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasf
    dgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsm
    vlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqv
    eyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshf
    ikqcfslp