PDB entry 3wq8

View 3wq8 on RCSB PDB site
Description: Monomer structure of hyperthermophilic beta-glucosidase mutant forming a dodecameric structure in the crystal form
Class: hydrolase
Keywords: tim barrel, hydrolase, sugar binding, hydrolysis
Deposited on 2014-01-23, released 2014-07-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-07-09, with a file datestamp of 2014-07-03.
Experiment type: XRAY
Resolution: 2.81 Å
R-factor: 0.245
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-glucosidase
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: CELB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51723 (2-449)
      • engineered mutation (170)
      • engineered mutation (220)
      • engineered mutation (227)
      • engineered mutation (447-449)
    Domains in SCOPe 2.05: d3wq8a_
  • Chain 'B':
    Compound: Beta-glucosidase
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: CELB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51723 (2-449)
      • engineered mutation (170)
      • engineered mutation (220)
      • engineered mutation (227)
      • engineered mutation (447-449)
    Domains in SCOPe 2.05: d3wq8b_
  • Chain 'C':
    Compound: Beta-glucosidase
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: CELB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51723 (2-449)
      • engineered mutation (170)
      • engineered mutation (220)
      • engineered mutation (227)
      • engineered mutation (447-449)
    Domains in SCOPe 2.05: d3wq8c_
  • Chain 'D':
    Compound: Beta-glucosidase
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: CELB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51723 (2-449)
      • engineered mutation (170)
      • engineered mutation (220)
      • engineered mutation (227)
      • engineered mutation (447-449)
    Domains in SCOPe 2.05: d3wq8d_
  • Chain 'E':
    Compound: Beta-glucosidase
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: CELB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51723 (2-449)
      • engineered mutation (170)
      • engineered mutation (220)
      • engineered mutation (227)
      • engineered mutation (447-449)
    Domains in SCOPe 2.05: d3wq8e_
  • Chain 'F':
    Compound: Beta-glucosidase
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: CELB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51723 (2-449)
      • engineered mutation (170)
      • engineered mutation (220)
      • engineered mutation (227)
      • engineered mutation (447-449)
    Domains in SCOPe 2.05: d3wq8f_
  • Chain 'G':
    Compound: Beta-glucosidase
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: CELB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51723 (2-449)
      • engineered mutation (170)
      • engineered mutation (220)
      • engineered mutation (227)
      • engineered mutation (447-449)
    Domains in SCOPe 2.05: d3wq8g_
  • Chain 'H':
    Compound: Beta-glucosidase
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: CELB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51723 (2-449)
      • engineered mutation (170)
      • engineered mutation (220)
      • engineered mutation (227)
      • engineered mutation (447-449)
    Domains in SCOPe 2.05: d3wq8h_
  • Chain 'I':
    Compound: Beta-glucosidase
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: CELB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51723 (2-449)
      • engineered mutation (170)
      • engineered mutation (220)
      • engineered mutation (227)
      • engineered mutation (447-449)
    Domains in SCOPe 2.05: d3wq8i_
  • Chain 'J':
    Compound: Beta-glucosidase
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: CELB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51723 (2-449)
      • engineered mutation (170)
      • engineered mutation (220)
      • engineered mutation (227)
      • engineered mutation (447-449)
    Domains in SCOPe 2.05: d3wq8j_
  • Chain 'K':
    Compound: Beta-glucosidase
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: CELB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51723 (2-449)
      • engineered mutation (170)
      • engineered mutation (220)
      • engineered mutation (227)
      • engineered mutation (447-449)
    Domains in SCOPe 2.05: d3wq8k_
  • Chain 'L':
    Compound: Beta-glucosidase
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: CELB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51723 (2-449)
      • engineered mutation (170)
      • engineered mutation (220)
      • engineered mutation (227)
      • engineered mutation (447-449)
    Domains in SCOPe 2.05: d3wq8l_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wq8A (A:)
    makfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywh
    lykqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikele
    kianmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdaapagwldek
    tvvefvkfaafvayhlddlvdmwstmnepnvvynqgyinlasgfppgflsfeaaekakfn
    liqahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkl
    dwigvnyysrlvygakdghlvplpgygfmserggfaksgrpasdfgwemypeglenllky
    lnnayelpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewa
    qgfrmrfglvyvdfetkkrylrpsalvsvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wq8A (A:)
    kfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywhly
    kqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikeleki
    anmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdaapagwldektv
    vefvkfaafvayhlddlvdmwstmnepnvvynqgyinlasgfppgflsfeaaekakfnli
    qahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkldw
    igvnyysrlvygakdghlvplpgygfmserggfaksgrpasdfgwemypeglenllkyln
    nayelpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewaqg
    frmrfglvyvdfetkkrylrpsalvsvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wq8B (B:)
    makfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywh
    lykqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikele
    kianmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdaapagwldek
    tvvefvkfaafvayhlddlvdmwstmnepnvvynqgyinlasgfppgflsfeaaekakfn
    liqahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkl
    dwigvnyysrlvygakdghlvplpgygfmserggfaksgrpasdfgwemypeglenllky
    lnnayelpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewa
    qgfrmrfglvyvdfetkkrylrpsalvsvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wq8B (B:)
    kfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywhly
    kqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikeleki
    anmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdaapagwldektv
    vefvkfaafvayhlddlvdmwstmnepnvvynqgyinlasgfppgflsfeaaekakfnli
    qahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkldw
    igvnyysrlvygalvplpgygfmserggfaksgrpasdfgwemypeglenllkylnnaye
    lpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewaqgfrmr
    fglvyvdfetkkrylrpsalvsvk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3wq8C (C:)
    makfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywh
    lykqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikele
    kianmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdaapagwldek
    tvvefvkfaafvayhlddlvdmwstmnepnvvynqgyinlasgfppgflsfeaaekakfn
    liqahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkl
    dwigvnyysrlvygakdghlvplpgygfmserggfaksgrpasdfgwemypeglenllky
    lnnayelpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewa
    qgfrmrfglvyvdfetkkrylrpsalvsvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wq8C (C:)
    kfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywhly
    kqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikeleki
    anmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdaapagwldektv
    vefvkfaafvayhlddlvdmwstmnepnvvynqgyinlasgfppgflsfeaaekakfnli
    qahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkldw
    igvnyysrlvygalvplpgygfmserggfaksgrpasdfgwemypeglenllkylnnaye
    lpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewaqgfrmr
    fglvyvdfetkkrylrpsalvsvk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3wq8D (D:)
    makfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywh
    lykqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikele
    kianmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdaapagwldek
    tvvefvkfaafvayhlddlvdmwstmnepnvvynqgyinlasgfppgflsfeaaekakfn
    liqahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkl
    dwigvnyysrlvygakdghlvplpgygfmserggfaksgrpasdfgwemypeglenllky
    lnnayelpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewa
    qgfrmrfglvyvdfetkkrylrpsalvsvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wq8D (D:)
    kfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywhly
    kqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikeleki
    anmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdaapagwldektv
    vefvkfaafvayhlddlvdmwstmnepnvvynqgyinlasgfppgflsfeaaekakfnli
    qahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkldw
    igvnyysrlvygalvplpgygfmserggfaksgrpasdfgwemypeglenllkylnnaye
    lpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewaqgfrmr
    fglvyvdfetkkrylrpsalvsvk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3wq8E (E:)
    makfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywh
    lykqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikele
    kianmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdaapagwldek
    tvvefvkfaafvayhlddlvdmwstmnepnvvynqgyinlasgfppgflsfeaaekakfn
    liqahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkl
    dwigvnyysrlvygakdghlvplpgygfmserggfaksgrpasdfgwemypeglenllky
    lnnayelpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewa
    qgfrmrfglvyvdfetkkrylrpsalvsvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wq8E (E:)
    kfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywhly
    kqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikeleki
    anmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdaapagwldektv
    vefvkfaafvayhlddlvdmwstmnepnvvynqgyinlasgfppgflsfeaaekakfnli
    qahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkldw
    igvnyysrlvygalvplpgygfmserggfaksgrpasdfgwemypeglenllkylnnaye
    lpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewaqgfrmr
    fglvyvdfetkkrylrpsalvsvk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3wq8F (F:)
    makfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywh
    lykqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikele
    kianmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdaapagwldek
    tvvefvkfaafvayhlddlvdmwstmnepnvvynqgyinlasgfppgflsfeaaekakfn
    liqahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkl
    dwigvnyysrlvygakdghlvplpgygfmserggfaksgrpasdfgwemypeglenllky
    lnnayelpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewa
    qgfrmrfglvyvdfetkkrylrpsalvsvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wq8F (F:)
    kfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywhly
    kqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikeleki
    anmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdaapagwldektv
    vefvkfaafvayhlddlvdmwstmnepnvvynqgyinlasgfppgflsfeaaekakfnli
    qahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkldw
    igvnyysrlvygalvplpgygfmserggfaksgrpasdfgwemypeglenllkylnnaye
    lpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewaqgfrmr
    fglvyvdfetkkrylrpsalvsvk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3wq8G (G:)
    makfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywh
    lykqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikele
    kianmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdaapagwldek
    tvvefvkfaafvayhlddlvdmwstmnepnvvynqgyinlasgfppgflsfeaaekakfn
    liqahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkl
    dwigvnyysrlvygakdghlvplpgygfmserggfaksgrpasdfgwemypeglenllky
    lnnayelpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewa
    qgfrmrfglvyvdfetkkrylrpsalvsvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wq8G (G:)
    kfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywhly
    kqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikeleki
    anmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdaapagwldektv
    vefvkfaafvayhlddlvdmwstmnepnvvynqgyinlasgfppgflsfeaaekakfnli
    qahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkldw
    igvnyysrlvygakdghlvplpgygfmserggfaksgrpasdfgwemypeglenllkyln
    nayelpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewaqg
    frmrfglvyvdfetkkrylrpsalvsvk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3wq8H (H:)
    makfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywh
    lykqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikele
    kianmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdaapagwldek
    tvvefvkfaafvayhlddlvdmwstmnepnvvynqgyinlasgfppgflsfeaaekakfn
    liqahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkl
    dwigvnyysrlvygakdghlvplpgygfmserggfaksgrpasdfgwemypeglenllky
    lnnayelpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewa
    qgfrmrfglvyvdfetkkrylrpsalvsvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wq8H (H:)
    kfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywhly
    kqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikeleki
    anmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdaapagwldektv
    vefvkfaafvayhlddlvdmwstmnepnvvynqgyinlasgfppgflsfeaaekakfnli
    qahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkldw
    igvnyysrlvygakdghlvplpgygfmserggfaksgrpasdfgwemypeglenllkyln
    nayelpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewaqg
    frmrfglvyvdfetkkrylrpsalvsvk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3wq8I (I:)
    makfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywh
    lykqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikele
    kianmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdaapagwldek
    tvvefvkfaafvayhlddlvdmwstmnepnvvynqgyinlasgfppgflsfeaaekakfn
    liqahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkl
    dwigvnyysrlvygakdghlvplpgygfmserggfaksgrpasdfgwemypeglenllky
    lnnayelpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewa
    qgfrmrfglvyvdfetkkrylrpsalvsvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wq8I (I:)
    kfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywhly
    kqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikeleki
    anmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdaapagwldektv
    vefvkfaafvayhlddlvdmwstmnepnvvynqgyinlasgfppgflsfeaaekakfnli
    qahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkldw
    igvnyysrlvygalvplpgygfmserggfaksgrpasdfgwemypeglenllkylnnaye
    lpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewaqgfrmr
    fglvyvdfetkkrylrpsalvsvk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3wq8J (J:)
    makfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywh
    lykqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikele
    kianmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdaapagwldek
    tvvefvkfaafvayhlddlvdmwstmnepnvvynqgyinlasgfppgflsfeaaekakfn
    liqahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkl
    dwigvnyysrlvygakdghlvplpgygfmserggfaksgrpasdfgwemypeglenllky
    lnnayelpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewa
    qgfrmrfglvyvdfetkkrylrpsalvsvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wq8J (J:)
    kfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywhly
    kqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikeleki
    anmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdaapagwldektv
    vefvkfaafvayhlddlvdmwstmnepnvvynqgyinlasgfppgflsfeaaekakfnli
    qahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkldw
    igvnyysrlvygalvplpgygfmserggfaksgrpasdfgwemypeglenllkylnnaye
    lpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewaqgfrmr
    fglvyvdfetkkrylrpsalvsvk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3wq8K (K:)
    makfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywh
    lykqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikele
    kianmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdaapagwldek
    tvvefvkfaafvayhlddlvdmwstmnepnvvynqgyinlasgfppgflsfeaaekakfn
    liqahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkl
    dwigvnyysrlvygakdghlvplpgygfmserggfaksgrpasdfgwemypeglenllky
    lnnayelpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewa
    qgfrmrfglvyvdfetkkrylrpsalvsvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wq8K (K:)
    kfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywhly
    kqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikeleki
    anmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdaapagwldektv
    vefvkfaafvayhlddlvdmwstmnepnvvynqgyinlasgfppgflsfeaaekakfnli
    qahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkldw
    igvnyysrlvygalvplpgygfmserggfaksgrpasdfgwemypeglenllkylnnaye
    lpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewaqgfrmr
    fglvyvdfetkkrylrpsalvsvk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3wq8L (L:)
    makfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywh
    lykqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikele
    kianmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdaapagwldek
    tvvefvkfaafvayhlddlvdmwstmnepnvvynqgyinlasgfppgflsfeaaekakfn
    liqahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkl
    dwigvnyysrlvygakdghlvplpgygfmserggfaksgrpasdfgwemypeglenllky
    lnnayelpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewa
    qgfrmrfglvyvdfetkkrylrpsalvsvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wq8L (L:)
    kfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywhly
    kqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikeleki
    anmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdaapagwldektv
    vefvkfaafvayhlddlvdmwstmnepnvvynqgyinlasgfppgflsfeaaekakfnli
    qahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkldw
    igvnyysrlvygakdghlvplpgygfmserggfaksgrpasdfgwemypeglenllkyln
    nayelpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewaqg
    frmrfglvyvdfetkkrylrpsalvsvk