PDB entry 3wq6

View 3wq6 on RCSB PDB site
Description: beta-Primeverosidase in complex with disaccharide substrate-analog N-beta-primeverosylamidine, artificial aglycone derivative
Class: hydrolase
Keywords: diglycosidase, diglycoside, disaccharide, glycoside hydrolase family 1 (gh1), (beta/alpha)8 barrel, specific hydrolysis of beta-primeverosides, aroma formation, oolong tea, black tea, hydrolase
Deposited on 2014-01-22, released 2014-04-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-01, with a file datestamp of 2015-03-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-primeverosidase
    Species: Camellia sinensis [TaxId:4442]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3wq6a_
  • Chain 'B':
    Compound: beta-primeverosidase
    Species: Camellia sinensis [TaxId:4442]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3wq6b_
  • Heterogens: ZPA, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wq6A (A:)
    mmaakgsvvvgvlaivayalvvsevaiaaqissfnrtsfpdgfvfgaassayqfegaake
    ggkgpniwdtfthefpgkisngstgdvaddfyhrykedvkvlkfigldgfrmsiswarvl
    prgklsggvnkegiafynnvindllskgiqpfitifhwdlpqaledeyggflsphivndf
    rdfaelcfkefgdrvkhwitmnepwsysyggydagllapgrcsafmafcpkgnsgtepyi
    vthnlllshaaavklykekyqayqkgqigitlvtywmipysnskadkdaaqraldfmygw
    fieplsfgeypksmrrlvgkrlprftkeqamlvkgsfdflglnyyianyvlnvptsnsvn
    lsyttdslsnqtafrngvaigrptgvpaffmypkglkdllvytkekyndpviyitengmg
    dnnnvtteegikdpqrvyfynqhllslknaiaagvkvkgyftwafldnfewlsgytqrfg
    ivyvdfkdglkrypkhsalwfkkfllk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wq6A (A:)
    ssfnrtsfpdgfvfgaassayqfegaakeggkgpniwdtfthefpgkisngstgdvaddf
    yhrykedvkvlkfigldgfrmsiswarvlprgklsggvnkegiafynnvindllskgiqp
    fitifhwdlpqaledeyggflsphivndfrdfaelcfkefgdrvkhwitmnepwsysygg
    ydagllapgrcsafmafcpkgnsgtepyivthnlllshaaavklykekyqayqkgqigit
    lvtywmipysnskadkdaaqraldfmygwfieplsfgeypksmrrlvgkrlprftkeqam
    lvkgsfdflglnyyianyvlnvptsnsvnlsyttdslsnqtafrngvaigrptgvpaffm
    ypkglkdllvytkekyndpviyitengmgdnnnvtteegikdpqrvyfynqhllslknai
    aagvkvkgyftwafldnfewlsgytqrfgivyvdfkdglkrypkhsalwfkkfll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wq6B (B:)
    mmaakgsvvvgvlaivayalvvsevaiaaqissfnrtsfpdgfvfgaassayqfegaake
    ggkgpniwdtfthefpgkisngstgdvaddfyhrykedvkvlkfigldgfrmsiswarvl
    prgklsggvnkegiafynnvindllskgiqpfitifhwdlpqaledeyggflsphivndf
    rdfaelcfkefgdrvkhwitmnepwsysyggydagllapgrcsafmafcpkgnsgtepyi
    vthnlllshaaavklykekyqayqkgqigitlvtywmipysnskadkdaaqraldfmygw
    fieplsfgeypksmrrlvgkrlprftkeqamlvkgsfdflglnyyianyvlnvptsnsvn
    lsyttdslsnqtafrngvaigrptgvpaffmypkglkdllvytkekyndpviyitengmg
    dnnnvtteegikdpqrvyfynqhllslknaiaagvkvkgyftwafldnfewlsgytqrfg
    ivyvdfkdglkrypkhsalwfkkfllk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wq6B (B:)
    sfnrtsfpdgfvfgaassayqfegaakeggkgpniwdtfthefpgkisngstgdvaddfy
    hrykedvkvlkfigldgfrmsiswarvlprgklsggvnkegiafynnvindllskgiqpf
    itifhwdlpqaledeyggflsphivndfrdfaelcfkefgdrvkhwitmnepwsysyggy
    dagllapgrcsafmafcpkgnsgtepyivthnlllshaaavklykekyqayqkgqigitl
    vtywmipysnskadkdaaqraldfmygwfieplsfgeypksmrrlvgkrlprftkeqaml
    vkgsfdflglnyyianyvlnvptsnsvnlsyttdslsnqtafrngvaigrptgvpaffmy
    pkglkdllvytkekyndpviyitengmgdnnnvtteegikdpqrvyfynqhllslknaia
    agvkvkgyftwafldnfewlsgytqrfgivyvdfkdglkrypkhsalwfkkfll