PDB entry 3wp6

View 3wp6 on RCSB PDB site
Description: The complex structure of CDBFV E109A with xylotriose
Class: hydrolase
Keywords: xylanase, regulatory N-terminal region, disulfide bond, industrial enzyme, beta-jellyroll fold, HYDROLASE
Deposited on 2014-01-09, released 2014-03-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-03-19, with a file datestamp of 2014-03-14.
Experiment type: XRAY
Resolution: 1.43 Å
R-factor: 0.13
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cdbfv
    Species: NEOCALLIMASTIX PATRICIARUM [TaxId:4758]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3WP6 (0-227)
    Domains in SCOPe 2.06: d3wp6a_
  • Heterogens: BXP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3wp6A (A:)
    aefqsfcssashsgqsvkvtgnkvgtiggvgyelwadsgnnsatfysdgsfsctfqnagd
    ylcrsglsfdstktpsqigrmkadfklvkqnssnvgysyvgvygwtrsplvayyivdnwl
    spfppgdwvgnkkhgsftidgaqytvyentrtgpsidgdttfnqyfsirqqardcgtidi
    sahfdqweklgmtmgklheakvlgeagnvnggasgtadfpyakvyigd