PDB entry 3wp3

View 3wp3 on RCSB PDB site
Description: Xylanase 11C from Talaromyces cellulolyticus (formerly known as Acremonium cellulolyticus)
Class: hydrolase
Keywords: Beta-jelly roll, Glycoside hydrolase, HYDROLASE
Deposited on 2014-01-09, released 2014-11-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-11-26, with a file datestamp of 2014-11-21.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.234
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase
    Species: Talaromyces funiculosus [TaxId:28572]
    Gene: XYNC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HFH0 (Start-206)
      • engineered mutation (58)
      • engineered mutation (84)
      • engineered mutation (120)
      • engineered mutation (140)
    Domains in SCOPe 2.05: d3wp3a_
  • Chain 'B':
    Compound: endo-1,4-beta-xylanase
    Species: Talaromyces funiculosus [TaxId:28572]
    Gene: XYNC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HFH0 (Start-206)
      • engineered mutation (58)
      • engineered mutation (84)
      • engineered mutation (120)
      • engineered mutation (140)
    Domains in SCOPe 2.05: d3wp3b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wp3A (A:)
    mfpsgltqhatgdlskrqsittsqtgtnngyyysfwtngggevtytngdngeysvtwvnc
    gdftsgkgwnpanaqtvtysgefntsgnaylavygwttdplveyyilesygtynpssglt
    llgqvtsdggtydiystqrvdqpsiegtstfnqywsvrtekrvggtvttanhfaawkalg
    lemgtynymivstegyessgsstitvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wp3A (A:)
    qsittsqtgtnngyyysfwtngggevtytngdngeysvtwvncgdftsgkgwnpanaqtv
    tysgefntsgnaylavygwttdplveyyilesygtynpssgltllgqvtsdggtydiyst
    qrvdqpsiegtstfnqywsvrtekrvggtvttanhfaawkalglemgtynymivstegye
    ssgsstitvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wp3B (B:)
    mfpsgltqhatgdlskrqsittsqtgtnngyyysfwtngggevtytngdngeysvtwvnc
    gdftsgkgwnpanaqtvtysgefntsgnaylavygwttdplveyyilesygtynpssglt
    llgqvtsdggtydiystqrvdqpsiegtstfnqywsvrtekrvggtvttanhfaawkalg
    lemgtynymivstegyessgsstitvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wp3B (B:)
    qsittsqtgtnngyyysfwtngggevtytngdngeysvtwvncgdftsgkgwnpanaqtv
    tysgefntsgnaylavygwttdplveyyilesygtynpssgltllgqvtsdggtydiyst
    qrvdqpsiegtstfnqywsvrtekrvggtvttanhfaawkalglemgtynymivstegye
    ssgsstitvs