PDB entry 3wo9

View 3wo9 on RCSB PDB site
Description: Crystal structure of the lamprey variable lymphocyte receptor C
Class: immune system
Keywords: Leucine rich repeat, immunological receptor, Membrane, IMMUNE SYSTEM
Deposited on 2013-12-20, released 2014-03-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-05, with a file datestamp of 2014-02-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.184
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Variable lymphocyte receptor C
    Species: Lethenteron camtschaticum [TaxId:980415]
    Gene: VLRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot E0D2V6 (26-End)
      • expression tag (24-25)
    Domains in SCOPe 2.07: d3wo9a1, d3wo9a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wo9A (A:)
    mnhkhhhhhhhhhhssgenlyfqghmaclavgkddictcsnktdsspetvdcsskkltav
    ptgipanteklqldfnqlanipaeafhgltrltylaldynqlqslpvgvfdqlnnlnelr
    lqdnqltslppgvfdsltkltyltlsqnqlqsipagvfdkltnlnrlelstnqlqsvphg
    afdslvnletlhlelnpwdcacsdiiylrtfiakntdkisgmesaqcngtstavkdvnte
    kiknvtcn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wo9A (A:)
    hmaclavgkddictcsnktdsspetvdcsskkltavptgipanteklqldfnqlanipae
    afhgltrltylaldynqlqslpvgvfdqlnnlnelrlqdnqltslppgvfdsltkltylt
    lsqnqlqsipagvfdkltnlnrlelstnqlqsvphgafdslvnletlhlelnpwdcacsd
    iiylrtfiakntdkisgmesaqcngtstavkdvntekiknvtc