PDB entry 3wo4

View 3wo4 on RCSB PDB site
Description: Crystal structure of the IL-18 signaling ternary complex
Class: immune system
Keywords: ternary complex, beta trefoil fold (ligand), three immunoglobulin-like domains (receptors), immunity, inflammation, autoimmunity, allergy, glycosylation, serum, membrane, IMMUNE SYSTEM
Deposited on 2013-12-19, released 2014-12-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interleukin-18
    Species: Homo sapiens [TaxId:9606]
    Gene: IL18
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3wo4a_
  • Chain 'B':
    Compound: Interleukin-18 receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: IL18R1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13478 (2-End)
      • expression tag (0-1)
  • Chain 'C':
    Compound: Interleukin-18 receptor accessory protein
    Species: Homo sapiens [TaxId:9606]
    Gene: IL18RAP
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3wo4A (A:)
    yfgklesklsvirnlndqvlfidqgnrplfedmtdsdcrdnaprtifiismykdsqprgm
    avtisvkcekistlscenkiisfkemnppdnikdtksdiiffqrsvpghdnkmqfesssy
    egyflacekerdlfklilkkedelgdrsimftvqned
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.