PDB entry 3wo3

View 3wo3 on RCSB PDB site
Description: Crystal structure of IL-18 in complex with IL-18 receptor alpha
Class: immune system
Keywords: binary complex, beta trefoil fold (ligand), three immunoglobulin-like domains (receptor), immunity, inflammation, autoimmunity, allergy, interleukin-18 receptor beta, glycosylation, serum, membrane, IMMUNE SYSTEM
Deposited on 2013-12-19, released 2014-12-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interleukin-18
    Species: Homo sapiens [TaxId:9606]
    Gene: IL18
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3wo3a_
  • Chain 'B':
    Compound: Interleukin-18 receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: IL18R1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13478 (2-End)
      • expression tag (1)
  • Chain 'C':
    Compound: Interleukin-18
    Species: Homo sapiens [TaxId:9606]
    Gene: IL18
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3wo3c_
  • Chain 'D':
    Compound: Interleukin-18 receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: IL18R1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13478 (2-End)
      • expression tag (1)
  • Chain 'E':
    Compound: Interleukin-18
    Species: Homo sapiens [TaxId:9606]
    Gene: IL18
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3wo3e_
  • Chain 'F':
    Compound: Interleukin-18 receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: IL18R1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13478 (2-End)
      • expression tag (0-1)
  • Chain 'G':
    Compound: Interleukin-18
    Species: Homo sapiens [TaxId:9606]
    Gene: IL18
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3wo3g_
  • Chain 'H':
    Compound: Interleukin-18 receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: IL18R1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13478 (2-End)
      • expression tag (1)
  • Chain 'I':
    Compound: Interleukin-18
    Species: Homo sapiens [TaxId:9606]
    Gene: IL18
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3wo3i_
  • Chain 'J':
    Compound: Interleukin-18 receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: IL18R1
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Interleukin-18
    Species: Homo sapiens [TaxId:9606]
    Gene: IL18
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3wo3k_
  • Chain 'L':
    Compound: Interleukin-18 receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: IL18R1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wo3A (A:)
    yfgklesklsvirnlndqvlfidqgnrplfedmtdsdcrdnaprtifiismykdsqprgm
    avtisvkcekistlscenkiisfkemnppdnikdtksdiiffqrsvpghdnkmqfesssy
    egyflacekerdlfklilkkedelgdrsimftvqned
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wo3A (A:)
    yfgklesklsvirnlndqvlfidqgnrplfedmtdsdcrdnaprtifiismykdsqprgm
    avtisvkcekistlscenkiisfkemnppdnikdtksdiiffqrsvpghdnkmqfesssy
    egyflacekerdlfklilkkedelgdrsimftvqne
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3wo3C (C:)
    yfgklesklsvirnlndqvlfidqgnrplfedmtdsdcrdnaprtifiismykdsqprgm
    avtisvkcekistlscenkiisfkemnppdnikdtksdiiffqrsvpghdnkmqfesssy
    egyflacekerdlfklilkkedelgdrsimftvqned
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wo3C (C:)
    yfgklesklsvirnlndqvlfidqgnrplfedmtdsdcrdnaprtifiismykdsqprgm
    avtisvkcekistlscenkiisfkemnppdnikdtksdiiffqrsvpghdnkmqfesssy
    egyflacekerdlfklilkkedelgdrsimftvqne
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3wo3E (E:)
    yfgklesklsvirnlndqvlfidqgnrplfedmtdsdcrdnaprtifiismykdsqprgm
    avtisvkcekistlscenkiisfkemnppdnikdtksdiiffqrsvpghdnkmqfesssy
    egyflacekerdlfklilkkedelgdrsimftvqned
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3wo3G (G:)
    yfgklesklsvirnlndqvlfidqgnrplfedmtdsdcrdnaprtifiismykdsqprgm
    avtisvkcekistlscenkiisfkemnppdnikdtksdiiffqrsvpghdnkmqfesssy
    egyflacekerdlfklilkkedelgdrsimftvqned
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wo3G (G:)
    yfgklesklsvirnlndqvlfidqgnrplfedmtdsdcrdnaprtifiismykdsqprgm
    avtisvkcekistlscenkiisfkemnppdnikdtksdiiffqrsvpghdnkmqfesssy
    egyflacekerdlfklilkkedelgdrsimftvqne
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3wo3I (I:)
    yfgklesklsvirnlndqvlfidqgnrplfedmtdsdcrdnaprtifiismykdsqprgm
    avtisvkcekistlscenkiisfkemnppdnikdtksdiiffqrsvpghdnkmqfesssy
    egyflacekerdlfklilkkedelgdrsimftvqned
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wo3I (I:)
    yfgklesklsvirnlndqvlfidqgnrplfedmtdsdcrdnaprtifiismykdsqprgm
    avtisvkcekistlscenkiisfkemnppdnikdtksdiiffqrsvpghdnkmqfesssy
    egyflacekerdlfklilkkedelgdrsimftvqne
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3wo3K (K:)
    yfgklesklsvirnlndqvlfidqgnrplfedmtdsdcrdnaprtifiismykdsqprgm
    avtisvkcekistlscenkiisfkemnppdnikdtksdiiffqrsvpghdnkmqfesssy
    egyflacekerdlfklilkkedelgdrsimftvqned
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wo3K (K:)
    yfgklesklsvirnlndqvlfidqgnrplfedmtdsdcrdnaprtifiismykdsqprgm
    avtisvkcekistlscenkiisfkemnppdnikdtksdiiffqrsvpghdnkmqfesssy
    egyflacekerdlfklilkkedelgdrsimftvqne
    

  • Chain 'L':
    No sequence available.