PDB entry 3wny

View 3wny on RCSB PDB site
Description: A simplified BPTI variant with poly Lys amino acid tag (C3K) at the C-terminus
Class: hydrolase inhibitor
Keywords: Single domain protein, Trypsin Inhibitory, Trypsin, HYDROLASE INHIBITOR
Deposited on 2013-12-18, released 2014-06-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-06-18, with a file datestamp of 2014-06-13.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.261
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bovine pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3WNY (0-End)
    Domains in SCOPe 2.07: d3wnya_
  • Chain 'B':
    Compound: bovine pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3WNY (0-End)
    Domains in SCOPe 2.07: d3wnyb_
  • Chain 'C':
    Compound: bovine pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3WNY (0-End)
    Domains in SCOPe 2.07: d3wnyc_
  • Chain 'E':
    Compound: bovine pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3WNY (0-End)
    Domains in SCOPe 2.07: d3wnye_
  • Chain 'F':
    Compound: bovine pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3WNY (0-End)
    Domains in SCOPe 2.07: d3wnyf_
  • Chain 'G':
    Compound: bovine pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3WNY (0-End)
    Domains in SCOPe 2.07: d3wnyg_
  • Chain 'H':
    Compound: bovine pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3WNY (0-End)
    Domains in SCOPe 2.07: d3wnyh_
  • Chain 'I':
    Compound: bovine pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3WNY (0-End)
    Domains in SCOPe 2.07: d3wnyi_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wnyA (A:)
    rpafcleppyagpgkariiryfynakagaaqafvyggvrakrnnfasaadalaacaaagg
    kkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wnyA (A:)
    rpafcleppyagpgkariiryfynakagaaqafvyggvrakrnnfasaadalaaca
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wnyB (B:)
    rpafcleppyagpgkariiryfynakagaaqafvyggvrakrnnfasaadalaacaaagg
    kkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wnyB (B:)
    rpafcleppyagpgkariiryfynakagaaqafvyggvrakrnnfasaadalaacaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3wnyC (C:)
    rpafcleppyagpgkariiryfynakagaaqafvyggvrakrnnfasaadalaacaaagg
    kkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wnyC (C:)
    rpafcleppyagpgkariiryfynakagaaqafvyggvrakrnnfasaadalaacaa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3wnyE (E:)
    rpafcleppyagpgkariiryfynakagaaqafvyggvrakrnnfasaadalaacaaagg
    kkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wnyE (E:)
    rpafcleppyagpgkariiryfynakagaaqafvyggvrakrnnfasaadalaaca
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3wnyF (F:)
    rpafcleppyagpgkariiryfynakagaaqafvyggvrakrnnfasaadalaacaaagg
    kkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wnyF (F:)
    rpafcleppyagpgkariiryfynakagaaqafvyggvrakrnnfasaadalaacaa
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3wnyG (G:)
    rpafcleppyagpgkariiryfynakagaaqafvyggvrakrnnfasaadalaacaaagg
    kkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wnyG (G:)
    rpafcleppyagpgkariiryfynakagaaqafvyggvrakrnnfasaadalaacaa
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3wnyH (H:)
    rpafcleppyagpgkariiryfynakagaaqafvyggvrakrnnfasaadalaacaaagg
    kkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wnyH (H:)
    rpafcleppyagpgkariiryfynakagaaqafvyggvrakrnnfasaadalaaca
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3wnyI (I:)
    rpafcleppyagpgkariiryfynakagaaqafvyggvrakrnnfasaadalaacaaagg
    kkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wnyI (I:)
    rpafcleppyagpgkariiryfynakagaaqafvyggvrakrnnfasaadalaaca