PDB entry 3wns

View 3wns on RCSB PDB site
Description: Allyl isothiocyanate inhibitor complexed with Macrophage Migration Inhibitory Factor
Class: isomerase/isomerase inhibitor
Keywords: Cytokine, Tautomerase, isomerase, Allyl isothiocyante, ISOMERASE-ISOMERASE INHIBITOR complex
Deposited on 2013-12-16, released 2014-03-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: GLIF, MIF, MMIF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3wnsa_
  • Chain 'B':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: GLIF, MIF, MMIF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3wnsb_
  • Chain 'C':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: GLIF, MIF, MMIF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3wnsc_
  • Heterogens: 9AI, SO4, IPA, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3wnsA (A:)
    pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
    lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3wnsB (B:)
    pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
    lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3wnsC (C:)
    pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
    lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa