PDB entry 3wlu

View 3wlu on RCSB PDB site
Description: Crystal Structure of human galectin-9 NCRD with Selenolactose
Class: sugar binding protein
Keywords: selenolactose, beta sandwich, galectin, carbohydrate binding, SUGAR BINDING PROTEIN
Deposited on 2013-11-14, released 2014-11-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-11-05, with a file datestamp of 2014-10-31.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.173
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-9
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3wlua_
  • Chain 'B':
    Compound: Galectin-9
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3wlub_
  • Chain 'C':
    Compound: Galectin-9
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3wluc_
  • Chain 'D':
    Compound: Galectin-9
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3wlud_
  • Heterogens: LSE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wluA (A:)
    gsqapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiafhfnp
    rfedggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfvqyfh
    rvpfhrvdtisvngsvqlsyisfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wluA (A:)
    qapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiafhfnprf
    edggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfvqyfhrv
    pfhrvdtisvngsvqlsyisfq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wluB (B:)
    gsqapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiafhfnp
    rfedggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfvqyfh
    rvpfhrvdtisvngsvqlsyisfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wluB (B:)
    qapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiafhfnprf
    edggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfvqyfhrv
    pfhrvdtisvngsvqlsyisfq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3wluC (C:)
    gsqapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiafhfnp
    rfedggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfvqyfh
    rvpfhrvdtisvngsvqlsyisfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wluC (C:)
    qapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiafhfnprf
    edggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfvqyfhrv
    pfhrvdtisvngsvqlsyisfq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3wluD (D:)
    gsqapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiafhfnp
    rfedggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfvqyfh
    rvpfhrvdtisvngsvqlsyisfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wluD (D:)
    qapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiafhfnprf
    edggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfvqyfhrv
    pfhrvdtisvngsvqlsyisfq