PDB entry 3wks

View 3wks on RCSB PDB site
Description: Crystal structure of the SepCysS-SepCysE N-terminal domain complex from
Class: transferase
Keywords: aminoacyl tRNA synthesis, TRANSFERASE
Deposited on 2013-10-30, released 2014-07-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 3.03 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: O-phospho-L-seryl-tRNA:Cys-tRNA synthase
    Species: Methanocaldococcus jannaschii [TaxId:243232]
    Gene: MJ1678
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59072 (40-415)
      • expression tag (36-39)
    Domains in SCOPe 2.07: d3wksa1, d3wksa2
  • Chain 'B':
    Compound: O-phospho-L-seryl-tRNA:Cys-tRNA synthase
    Species: Methanocaldococcus jannaschii [TaxId:243232]
    Gene: MJ1678
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59072 (40-415)
      • expression tag (36-39)
    Domains in SCOPe 2.07: d3wksb1, d3wksb2
  • Chain 'C':
    Compound: Uncharacterized protein MJ1481
    Species: Methanocaldococcus jannaschii [TaxId:243232]
    Gene: MJ1481
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Uncharacterized protein MJ1481
    Species: Methanocaldococcus jannaschii [TaxId:243232]
    Gene: MJ1481
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wksA (A:)
    mgsshhhhhhssglvprgshmelegpyskkfevitldinldkyknltrsltrefinlnpi
    qrggilpkeakkavyeywdgysvcdychgrldevtcppikdflediakflnmdcarpthg
    aregkfivmhaickegdyvvldknahytsyvaaeraklnvaevgyeeeyptykinlegyk
    evidnledkgknvglillthvdgeygnlndakkvgkiakekgipfllncaytvgrmpvng
    kevkadfivasghksmaasapcgilafseefsdkitktsekfpvkeiemlgctsrglpiv
    tlmasfphvvervkkwdeelkktryvvdelekigfkqlgikpkehdlikfetpvldeiak
    kdkrrgfffydelkkrgiggiragvtkeikmsvygleweqveyvvnaikeivesck
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wksA (A:)
    dinldkyknltrsltrefinlnpiqrggilpkeakkavyeywdgppikdflediakflnm
    dcarpthgaregkfivmhaickegdyvvldknahytsyvaaeraklnvaevgyeeeypty
    kinlegykevidnledkgknvglillthvdgeygnlndakkvgkiakekgipfllncayt
    vgrmpvngkevkadfivasghksmaasapcgilafseefsdkitktsekfpvkeiemlgc
    tsrglpivtlmasfphvvervkkwdeelkktryvvdelekigfkqlgikpkehdlikfet
    pvldeiakkdkrrgfffydelkkrgiggiragvtkeikmsvygleweqveyvvnaikeiv
    esck
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wksB (B:)
    mgsshhhhhhssglvprgshmelegpyskkfevitldinldkyknltrsltrefinlnpi
    qrggilpkeakkavyeywdgysvcdychgrldevtcppikdflediakflnmdcarpthg
    aregkfivmhaickegdyvvldknahytsyvaaeraklnvaevgyeeeyptykinlegyk
    evidnledkgknvglillthvdgeygnlndakkvgkiakekgipfllncaytvgrmpvng
    kevkadfivasghksmaasapcgilafseefsdkitktsekfpvkeiemlgctsrglpiv
    tlmasfphvvervkkwdeelkktryvvdelekigfkqlgikpkehdlikfetpvldeiak
    kdkrrgfffydelkkrgiggiragvtkeikmsvygleweqveyvvnaikeivesck
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wksB (B:)
    dinldkyknltrsltrefinlnpiqrggilpkeakkavyeywdgysvcdtcppikdfled
    iakflnmdcarpthgaregkfivmhaickegdyvvldknahytsyvaaeraklnvaevgy
    eeeyptykinlegykevidnledkgknvglillthvdgeygnlndakkvgkiakekgipf
    llncaytvgrmpvngkevkadfivasghksmaasapcgilafseefsdkitktsekfpvk
    eiemlgctsrglpivtlmasfphvvervkkwdeelkktryvvdelekigfkqlgikpkeh
    dlikfetpvldeiakkdkrrgfffydelkkrgiggiragvtkeikmsvygleweqveyvv
    naikeivesck
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.