PDB entry 3wkr

View 3wkr on RCSB PDB site
Description: Crystal structure of the SepCysS-SepCysE complex from Methanocaldococcus jannaschii
Class: transferase
Keywords: aminoacyl tRNA synthesis, TRANSFERASE
Deposited on 2013-10-30, released 2014-07-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: O-phospho-L-seryl-tRNA:Cys-tRNA synthase
    Species: Methanocaldococcus jannaschii [TaxId:243232]
    Gene: MJ1678
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59072 (40-415)
      • expression tag (37-39)
    Domains in SCOPe 2.07: d3wkra1, d3wkra2
  • Chain 'B':
    Compound: O-phospho-L-seryl-tRNA:Cys-tRNA synthase
    Species: Methanocaldococcus jannaschii [TaxId:243232]
    Gene: MJ1678
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59072 (40-415)
      • expression tag (37-39)
    Domains in SCOPe 2.07: d3wkrb1, d3wkrb2
  • Chain 'C':
    Compound: Uncharacterized protein MJ1481
    Species: Methanocaldococcus jannaschii [TaxId:243232]
    Gene: MJ1481
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Uncharacterized protein MJ1481
    Species: Methanocaldococcus jannaschii [TaxId:243232]
    Gene: MJ1481
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: O-phospho-L-seryl-tRNA:Cys-tRNA synthase
    Species: Methanocaldococcus jannaschii [TaxId:243232]
    Gene: MJ1678
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59072 (40-415)
      • expression tag (37-39)
    Domains in SCOPe 2.07: d3wkre1, d3wkre2
  • Chain 'F':
    Compound: O-phospho-L-seryl-tRNA:Cys-tRNA synthase
    Species: Methanocaldococcus jannaschii [TaxId:243232]
    Gene: MJ1678
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59072 (40-415)
      • expression tag (37-39)
    Domains in SCOPe 2.07: d3wkrf1, d3wkrf2
  • Chain 'G':
    Compound: Uncharacterized protein MJ1481
    Species: Methanocaldococcus jannaschii [TaxId:243232]
    Gene: MJ1481
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Uncharacterized protein MJ1481
    Species: Methanocaldococcus jannaschii [TaxId:243232]
    Gene: MJ1481
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wkrA (A:)
    mgsshhhhhhssglvprgshmelegpyskkfevitldinldkyknltrsltrefinlnpi
    qrggilpkeakkavyeywdgysvcdychgrldevtcppikdflediakflnmdcarpthg
    aregkfivmhaickegdyvvldknahytsyvaaeraklnvaevgyeeeyptykinlegyk
    evidnledkgknvglillthvdgeygnlndakkvgkiakekgipfllncaytvgrmpvng
    kevkadfivasghksmaasapcgilafseefsdkitktsekfpvkeiemlgctsrglpiv
    tlmasfphvvervkkwdeelkktryvvdelekigfkqlgikpkehdlikfetpvldeiak
    kdkrrgfffydelkkrgiggiragvtkeikmsvygleweqveyvvnaikeivesck
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wkrA (A:)
    inldkyknltrsltrefinlnpiqrggilpkeakkavyeywdgpikdflediakflnmdc
    arpthgaregkfivmhaickegdyvvldknahytsyvaaeraklnvaevgyeeeyptyki
    nlegykevidnledkgknvglillthvdgeygnlndakkvgkiakekgipfllncaytvg
    rmpvngkevkadfivasghksmaasapcgilafseefsdkitktsekfpvkeiemlgcts
    rglpivtlmasfphvvervkkwdeelkktryvvdelekigfkqlgikpkehdlikfetpv
    ldeiakkdkrrgfffydelkkrgiggiragvtkeikmsvygleweqveyvvnaikeives
    ck
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wkrB (B:)
    mgsshhhhhhssglvprgshmelegpyskkfevitldinldkyknltrsltrefinlnpi
    qrggilpkeakkavyeywdgysvcdychgrldevtcppikdflediakflnmdcarpthg
    aregkfivmhaickegdyvvldknahytsyvaaeraklnvaevgyeeeyptykinlegyk
    evidnledkgknvglillthvdgeygnlndakkvgkiakekgipfllncaytvgrmpvng
    kevkadfivasghksmaasapcgilafseefsdkitktsekfpvkeiemlgctsrglpiv
    tlmasfphvvervkkwdeelkktryvvdelekigfkqlgikpkehdlikfetpvldeiak
    kdkrrgfffydelkkrgiggiragvtkeikmsvygleweqveyvvnaikeivesck
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wkrB (B:)
    inldkyknltrsltrefinlnpiqrggilpkeakkavyeywdgcppikdflediakflnm
    dcarpthgaregkfivmhaickegdyvvldknahytsyvaaeraklnvaevgyeeeypty
    kinlegykevidnledkgknvglillthvdgeygnlndakkvgkiakekgipfllncayt
    vgrmpvngkevkadfivasghksmaasapcgilafseefsdkitktsekfpvkeiemlgc
    tsrglpivtlmasfphvvervkkwdeelkktryvvdelekigfkqlgikpkehdlikfet
    pvldeiakkdkrrgfffydelkkrgiggiragvtkeikmsvygleweqveyvvnaikeiv
    esck
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3wkrE (E:)
    mgsshhhhhhssglvprgshmelegpyskkfevitldinldkyknltrsltrefinlnpi
    qrggilpkeakkavyeywdgysvcdychgrldevtcppikdflediakflnmdcarpthg
    aregkfivmhaickegdyvvldknahytsyvaaeraklnvaevgyeeeyptykinlegyk
    evidnledkgknvglillthvdgeygnlndakkvgkiakekgipfllncaytvgrmpvng
    kevkadfivasghksmaasapcgilafseefsdkitktsekfpvkeiemlgctsrglpiv
    tlmasfphvvervkkwdeelkktryvvdelekigfkqlgikpkehdlikfetpvldeiak
    kdkrrgfffydelkkrgiggiragvtkeikmsvygleweqveyvvnaikeivesck
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wkrE (E:)
    inldkyknltrsltrefinlnpiqrggilpkeakkavyeywdgtcppikdflediakfln
    mdcarpthgaregkfivmhaickegdyvvldknahytsyvaaeraklnvaevgyeeeypt
    ykinlegykevidnledkgknvglillthvdgeygnlndakkvgkiakekgipfllncay
    tvgrmpvngkevkadfivasghksmaasapcgilafseefsdkitktsekfpvkeiemlg
    ctsrglpivtlmasfphvvervkkwdeelkktryvvdelekigfkqlgikpkehdlikfe
    tpvldeiakkdkrrgfffydelkkrgiggiragvtkeikmsvygleweqveyvvnaikei
    vesck
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3wkrF (F:)
    mgsshhhhhhssglvprgshmelegpyskkfevitldinldkyknltrsltrefinlnpi
    qrggilpkeakkavyeywdgysvcdychgrldevtcppikdflediakflnmdcarpthg
    aregkfivmhaickegdyvvldknahytsyvaaeraklnvaevgyeeeyptykinlegyk
    evidnledkgknvglillthvdgeygnlndakkvgkiakekgipfllncaytvgrmpvng
    kevkadfivasghksmaasapcgilafseefsdkitktsekfpvkeiemlgctsrglpiv
    tlmasfphvvervkkwdeelkktryvvdelekigfkqlgikpkehdlikfetpvldeiak
    kdkrrgfffydelkkrgiggiragvtkeikmsvygleweqveyvvnaikeivesck
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wkrF (F:)
    inldkyknltrsltrefinlnpiqrggilpkeakkavyeywdgppikdflediakflnmd
    carpthgaregkfivmhaickegdyvvldknahytsyvaaeraklnvaevgyeeeyptyk
    inlegykevidnledkgknvglillthvdgeygnlndakkvgkiakekgipfllncaytv
    grmpvngkevkadfivasghksmaasapcgilafseefsdkitktsekfpvkeiemlgct
    srglpivtlmasfphvvervkkwdeelkktryvvdelekigfkqlgikpkehdlikfetp
    vldeiakkdkrrgfffydelkkrgiggiragvtkeikmsvygleweqveyvvnaikeive
    sck
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.