PDB entry 3wkg

View 3wkg on RCSB PDB site
Description: Crystal structure of cellobiose 2-epimerase in complex with glucosylmannose
Class: isomerase
Keywords: (alpha/alpha)6 barrel fold, Epimerase, Carbohydrate/Sugar Binding, Epimerization, ISOMERASE
Deposited on 2013-10-21, released 2013-12-25
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-12-25, with a file datestamp of 2013-12-20.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: 0.168
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellobiose 2-epimerase
    Species: Rhodothermus marinus [TaxId:29549]
    Gene: CE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3wkga_
  • Heterogens: CL, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wkgA (A:)
    mstetipdvrrlralqaevheeltenilkfwatrthdpvhggfvgrvgpdgrphpeaprg
    ailnarilwtfaaayrqlgtplyremaerayryfvrhfvdaehggvywmvaadgrpldtr
    khvyaqsfaiyalsewhratggeaalalarsiydliethcadrvhggyveacdrawrple
    darlsakdapeprsmnthlhvleayanlyrvwpetelaarlqalielflraiyhpatghl
    ilffderwrprsravsfghdieaswllleavdvlgqatlrprvqqaslhlaratlaegra
    pdgslyyeigeqghldtdrhwwpqaealvgflnayqesgevlfyeaaedvwryirerqrd
    trggewfarvrddgapypddkvdfwkgpyhngracleaiqrlrhllehvrsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wkgA (A:)
    tetipdvrrlralqaevheeltenilkfwatrthdpvhggfvgrvgpdgrphpeaprgai
    lnarilwtfaaayrqlgtplyremaerayryfvrhfvdaehggvywmvaadgrpldtrkh
    vyaqsfaiyalsewhratggeaalalarsiydliethcadrvhggyveacdrawrpleda
    rlsakdapeprsmnthlhvleayanlyrvwpetelaarlqalielflraiyhpatghlil
    ffderwrprsravsfghdieaswllleavdvlgqatlrprvqqaslhlaratlaegrapd
    gslyyeigeqghldtdrhwwpqaealvgflnayqesgevlfyeaaedvwryirerqrdtr
    ggewfarvrddgapypddkvdfwkgpyhngracleaiqrlrhllehvrsr