PDB entry 3wkf

View 3wkf on RCSB PDB site
Description: Crystal structure of cellobiose 2-epimerase
Class: isomerase
Keywords: (alpha/alpha)6 barrel fold, Epimerase, Carbohydrate/Sugar Binding, Epimerization, ISOMERASE
Deposited on 2013-10-21, released 2013-12-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-02-26, with a file datestamp of 2014-02-21.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.159
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellobiose 2-epimerase
    Species: Rhodothermus marinus [TaxId:29549]
    Gene: CE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3wkfa_
  • Heterogens: PO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wkfA (A:)
    mstetipdvrrlralqaevheeltenilkfwatrthdpvhggfvgrvgpdgrphpeaprg
    ailnarilwtfaaayrqlgtplyremaerayryfvrhfvdaehggvywmvaadgrpldtr
    khvyaqsfaiyalsewhratggeaalalarsiydliethcadrvhggyveacdrawrple
    darlsakdapeprsmnthlhvleayanlyrvwpetelaarlqalielflraiyhpatghl
    ilffderwrprsravsfghdieaswllleavdvlgqatlrprvqqaslhlaratlaegra
    pdgslyyeigeqghldtdrhwwpqaealvgflnayqesgevlfyeaaedvwryirerqrd
    trggewfarvrddgapypddkvdfwkgpyhngracleaiqrlrhllehvrsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wkfA (A:)
    tetipdvrrlralqaevheeltenilkfwatrthdpvhggfvgrvgpdgrphpeaprgai
    lnarilwtfaaayrqlgtplyremaerayryfvrhfvdaehggvywmvaadgrpldtrkh
    vyaqsfaiyalsewhratggeaalalarsiydliethcadrvhggyveacdrawrpleda
    rlsakdapeprsmnthlhvleayanlyrvwpetelaarlqalielflraiyhpatghlil
    ffderwrprsravsfghdieaswllleavdvlgqatlrprvqqaslhlaratlaegrapd
    gslyyeigeqghldtdrhwwpqaealvgflnayqesgevlfyeaaedvwryirerqrdtr
    ggewfarvrddgapypddkvdfwkgpyhngracleaiqrlrhllehv