PDB entry 3wk8

View 3wk8 on RCSB PDB site
Description: Crystal structure of soluble epoxide hydrolase in complex with fragment inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: Hydrolase, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2013-10-17, released 2014-04-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-16, with a file datestamp of 2014-04-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.202
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional epoxide hydrolase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHX2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wk8a1, d3wk8a2
  • Heterogens: MG, PO4, S0E, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wk8A (A:)
    mtlraavfdldgvlalpavfgvlgrteealalprgllndafqkggpegattrlmkgeitl
    sqwiplmeencrkcsetakvclpknfsikeifdkaisarkinrpmlqaalmlrkkgftta
    iltntwlddraerdglaqlmcelkmhfdfliescqvgmvkpepqiykflldtlkaspsev
    vflddiganlkpardlgmvtilvqdtdtalkelekvtgiqllntpaplptscnpsdmshg
    yvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyrvlamdmkgygess
    appeieeycmevlckemvtfldklglsqavfighdwggmlvwymalfypervravaslnt
    pfipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfkslfrasdesvlsmh
    kvceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyrnmernwkwacksl
    grkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtqmdkptevnqilik
    wldsdarnppvvskmhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wk8A (A:)
    tlraavfdldgvlalpavfgvlgrteealalprgllndafqkggpegattrlmkgeitls
    qwiplmeencrkcsetakvclpknfsikeifdkaisarkinrpmlqaalmlrkkgfttai
    ltntwlddraerdglaqlmcelkmhfdfliescqvgmvkpepqiykflldtlkaspsevv
    flddiganlkpardlgmvtilvqdtdtalkelekvtgiqllntpaplptscnpsdmshgy
    vtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyrvlamdmkgygessa
    ppeieeycmevlckemvtfldklglsqavfighdwggmlvwymalfypervravaslntp
    fipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfkslfrasdesvlsmhk
    vceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyrnmernwkwackslg
    rkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtqmdkptevnqilikw
    ldsdar