PDB entry 3wjy

View 3wjy on RCSB PDB site
Description: Orotidine 5'-monophosphate decarboxylase K72A mutant from M. thermoautotrophicus complexed with 6-amino-UMP
Class: lyase
Keywords: protein-ligand complex, TIM barrel, decarboxylase, pyrimidine biosynthesis, LYASE
Deposited on 2013-10-17, released 2013-12-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-12-04, with a file datestamp of 2013-11-29.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: 0.151
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:187420]
    Gene: pyrF, MTH_129
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • engineered mutation (74)
      • see remark 999 (103)
    Domains in SCOPe 2.07: d3wjya_
  • Heterogens: NUP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wjyA (A:)
    gshmrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiia
    efrkrfgcriiadfavadipetnekicratfkagadaiivhgfpgadsvraclnvaeemg
    revflltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsfl
    ispgvgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdlripedpaankar
    keaelaaataeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wjyA (A:)
    vmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiad
    favadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpg
    aemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpg
    etlrfadaiivgrsiyladnpaaaaagiiesikdl