PDB entry 3wjl

View 3wjl on RCSB PDB site
Description: Crystal structure of IIb selective Fc variant, Fc(V12), in complex with FcgRIIb
Class: immune system
Keywords: receptor complex, fc receptor, antibody, immune system
Deposited on 2013-10-11, released 2013-11-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-26, with a file datestamp of 2014-11-21.
Experiment type: XRAY
Resolution: 2.86 Å
R-factor: 0.232
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857
      • engineered mutation (17)
      • engineered mutation (21-22)
      • engineered mutation (52)
      • engineered mutation (55)
      • engineered mutation (114)
    Domains in SCOPe 2.06: d3wjla1, d3wjla2
  • Chain 'B':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857
      • engineered mutation (21-22)
      • engineered mutation (52)
      • engineered mutation (55)
      • engineered mutation (114)
    Domains in SCOPe 2.06: d3wjlb1, d3wjlb2
  • Chain 'C':
    Compound: Low affinity immunoglobulin gamma Fc region receptor II-c
    Species: Homo sapiens [TaxId:9606]
    Gene: FCGR2C, CD32, FCG2, IGFR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3wjlc1, d3wjlc2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wjlA (A:)
    epkssdkthtcppcpapdllgddsvflfppkpkdtlmisrtpevtcvvvdvsdedgevkf
    nwyvdgvevhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalprpiekt
    iskakgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttp
    pvldsdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wjlA (A:)
    pdllgddsvflfppkpkdtlmisrtpevtcvvvdvsdedgevkfnwyvdgvevhnaktkp
    reeqynstyrvvsvltvlhqdwlngkeykckvsnkalprpiektiskakgqprepqvytl
    ppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflysklt
    vdksrwqqgnvfscsvmhealhnhytqkslsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wjlB (B:)
    epkssdkthtcppcpapdllgddsvflfppkpkdtlmisrtpevtcvvvdvsdedgevkf
    nwyvdgvevhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalprpiekt
    iskakgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttp
    pvldsdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wjlB (B:)
    ddsvflfppkpkdtlmisrtpevtcvvvdvsdedgevkfnwyvdgvevhnaktkpreeqy
    nstyrvvsvltvlhqdwlngkeykckvsnkalprpiektiskakgqprepqvytlppsrd
    eltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksr
    wqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3wjlC (C:)
    aappkavlklepqwinvlqedsvtltcrgthspesdsiqwfhngnlipthtqpsyrfkan
    nndsgeytcqtgqtslsdpvhltvlsewlvlqtphlefqegetivlrchswkdkplvkvt
    ffqngkskkfsrsdpnfsipqanhshsgdyhctgnigytlysskpvtitvqaphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wjlC (C:)
    pkavlklepqwinvlqedsvtltcrsiqwfhngnlipthtqpsyrfkannndsgeytcqt
    gqtslsdpvhltvlsewlvlqtphlefqegetivlrchswkdkplvkvtffqngkskkfs
    rsdpnfsipqanhshsgdyhctgnigytlysskpvtitvq